Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit Polyclonal Anti-Syndecan4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Syndecan4 Antibody: A synthesized peptide derived from human Syndecan4 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
USD 509.00
In Stock
Rabbit Polyclonal antibody to Collagen III alpha1 (collagen, type III, alpha 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1247 and 1389 of Collagen III alpha1 |
SPP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SPP1 |
Rabbit anti-CD36 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD36 |
Rabbit anti-COMP Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human COMP |
Rabbit Polyclonal Anti-Fibronectin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fibronectin 1 Antibody: A synthesized peptide derived from human Fibronectin 1 |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Rabbit Polyclonal Anti-Collagen III Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Collagen III Antibody: A synthesized peptide derived from human Collagen III |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit anti-ITGB5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB5 |
Rabbit Polyclonal Anti-Vtn Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vtn antibody is: synthetic peptide directed towards the middle region of Rat Vtn. Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI |
Rabbit Polyclonal Anti-Collagen II Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Collagen II Antibody: A synthesized peptide derived from human Collagen II |
Rabbit Polyclonal Anti-Integrin beta-5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin beta-5 Antibody: A synthesized peptide derived from human Integrin beta-5 |
Rabbit Polyclonal Anti-Osteopontin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Osteopontin Antibody: A synthesized peptide derived from human Osteopontin |
Rabbit Polyclonal Anti-Fibronectin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fibronectin 1 Antibody: A synthesized peptide derived from human Fibronectin 1 |
Rabbit Polyclonal Anti-Integrin β4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin β4 Antibody: A synthesized peptide derived from human Integrin β4 |
Rabbit Polyclonal Anti-Integrin β1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin β1 Antibody: A synthesized peptide derived from human Integrin β1 |
Rabbit Polyclonal Anti-Collagen II Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Collagen II Antibody: A synthesized peptide derived from human Collagen II |
Rabbit polyclonal Integrin beta1 (Ab-789) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Anti-COL5A1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 69-82 amino acids of human collagen, type V, alpha 1 |
Rabbit Polyclonal CD44 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 |
Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Collagen I Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Collagen I |
Active filters
Reactivities
- Rat
Pathways
- ECM-receptor interaction
Filter by
Category
Target Symbol
- CD36 (20)
- FN1 (19)
- ITGB3 (16)
- ITGB1 (15)
- LAMA4 (10)
- COL3A1 (9)
- SPP1 (9)
- CD44 (6)
- ITGB6 (6)
- LAMB2 (6)
- COL5A2 (5)
- COL6A1 (5)
- ITGB4 (5)
- COL2A1 (4)
- ITGA4 (3)
- ITGAV (3)
- ITGB5 (3)
- LAMA1 (3)
- THBS1 (3)
- TNC (3)
- AGRN (2)
- COL1A2 (2)
- COL4A1 (2)
- COMP (2)
- GP6 (2)
- ITGA7 (2)
- LAMA3 (2)
- LAMB1 (2)
- SDC4 (2)
- TNN (2)
- TNR (2)
- TNXB (2)
- VTN (2)
- VWF (2)
- CD47 (1)
- CHAD (1)
- COL1A1 (1)
- COL5A1 (1)
- DAG1 (1)
- GP1BB (1)
- GP9 (1)
- HMMR (1)
- ITGA5 (1)
- LAMA5 (1)
- LAMC1 (1)
- SDC1 (1)
- SV2A (1)