Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
AKR1C3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKR1C3 |
Anti-ADH5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
GSTT1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GSTT1 |
Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit polyclonal CYP1A2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
UGT1A9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A9 |
Rabbit anti-EPHX1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPHX1 |
Rabbit anti-CYP1A1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CYP1A1 |
Rabbit anti-UGT2B7 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT2B7 |
Rabbit Polyclonal Anti-Adh7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Adh7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Adh7. Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL |
Rabbit polyclonal ADH1B Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
GSTA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GSTA1 |
Rabbit anti-UGT1A4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A4 |
Rabbit anti-GSTO2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GSTO2 |
Rabbit Polyclonal Anti-CYP2B6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
Rabbit polyclonal Cytochrome P450 1A1/2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2. |
Rabbit polyclonal Cytochrome P450 1A2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Rabbit polyclonal anti-MGST3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MGST3. |
Rabbit polyclonal ADH4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ADH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-348 amino acids from the C-terminal region of human ADH4. |
Rabbit polyclonal GSTM1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1. |
Goat Polyclonal Antibody against GST3 / GSTP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LADQGQSWKEEV, from the internal region of the protein sequence according to NP_000843.1. |
Goat Polyclonal Antibody against ADH1A, B, C
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STAGKVMKCKA, from the N Terminus of the protein sequence according to NP_000658.1; NP_000659.2; NP_000660.1. |
Goat Anti-ADH5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKIKVDEFVTHN, from the internal region of the protein sequence according to NP_000662.3 . |
Rabbit Polyclonal Aldh3A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1. |
Goat Anti-ALDH3B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDLHKSAFESEVSE, from the internal region of the protein sequence according to NP_000685.1. |
Anti-GSTT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-GSTM2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
USD 1,140.00
2 Weeks
Mouse monoclonal Anti-CYP1A2 Clone D15
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti ARK1C2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2B6 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Pathways
- Metabolism of xenobiotics by cytochrome P450
Filter by
Category
Target Symbol
- ADH5 (28)
- ALDH1A3 (20)
- ADH7 (16)
- GSTP1 (14)
- EPHX1 (13)
- GSTZ1 (10)
- CYP1A1 (7)
- CYP2B6 (7)
- ALDH3A1 (4)
- ADH1A (3)
- ADH1B (3)
- ADH4 (3)
- ALDH3B1 (3)
- CYP1A2 (3)
- CYP1B1 (3)
- CYP2E1 (3)
- CYP3A4 (3)
- AKR1C1 (2)
- GSTM1 (2)
- GSTT1 (2)
- UGT1A9 (2)
- AKR1C2 (1)
- AKR1C3 (1)
- AKR1C4 (1)
- CYP2S1 (1)
- GSTA1 (1)
- GSTM2 (1)
- GSTO2 (1)
- MGST3 (1)
- UGT1A1 (1)
- UGT1A4 (1)
- UGT2B7 (1)