Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CAT Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAT antibody: synthetic peptide directed towards the middle region of human CAT. Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG |
Rabbit Polyclonal Anti-MDS032 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE |
Rabbit polyclonal Syntaxin 1A (Ser14) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Syntaxin 1A around the phosphorylation site of serine 14 (K-D-SP-D-D) |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-C1orf142 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: DQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKL |
Rabbit Polyclonal Anti-SNAP23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAP23 antibody: synthetic peptide directed towards the N terminal of human SNAP23. Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC |
Rabbit Polyclonal Anti-SNAP25 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAP25 Antibody: A synthesized peptide derived from human SNAP25 |
Rabbit Polyclonal Anti-VTI1a Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VTI1a antibody was raised against a 19 amino acid peptide near the center of human VTI1a. |
Goat Polyclonal Anti-STX6 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli. |
Goat Polyclonal Antibody against SNAP25
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEANQRATKMLGSG, from the C Terminus of the protein sequence according to NP_003072.2; NP_570824.1. |
Rabbit polyclonal anti-VTI1B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human VTI1B. |
Rabbit polyclonal anti-VTI1A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human VTI1A. |
Rabbit Polyclonal Syntaxin 1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A |
Rabbit Polyclonal Syntaxin 1A (Ser14) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A around the phosphorylation site of Serine 14 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STX11 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal antibody to Syntaxin 4 (syntaxin 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 92 and 297 of Syntaxin 4 (Uniprot ID#Q12846) |
Rabbit polyclonal anti-VAMP8 antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This VAMP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VAMP8. |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: ARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKS |
Goat Polyclonal Antibody against BNIP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLLRQRKTTKESLAQ, from the internal region of the protein sequence according to NP_001196.1; NP_053581.1; NP_053582.1; NP_053583.1. |
Goat Polyclonal Antibody against STX6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QALAERKNRQA, from the internal region of the protein sequence according to NP_005810.1. |
Goat Polyclonal Antibody against VTI1B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RDFDEKQQEANET, from the internal region of the protein sequence according to NP_006361.1. |
Mouse Anti-Synaptobrevin (VAMP) Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Mouse Anti-Syntaxin Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Porcine, Rat |
| Conjugation | Unconjugated |
Goat Anti-SNAP23 (aa 135-144) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TDKADTNRDR, from the C Terminus of the protein sequence according to NP_003816.2; NP_570710.1. |
Rabbit polyclonal anti-SEC22B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human SEC22B. |
Goat Anti-syntaxin 11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KQADTLNVIELNVQK, from the internal region of the protein sequence according to NP_003755.2. |
Rabbit polyclonal anti-STX1B antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STX1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human STX1B. |
Rabbit Polyclonal Anti-STX1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX1A antibody: synthetic peptide directed towards the N terminal of human STX1A. Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV |
Rabbit Polyclonal Anti-STX19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STX19 Antibody: synthetic peptide directed towards the N terminal of human STX19. Synthetic peptide located within the following region: LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: EKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQT |
Rabbit Polyclonal Anti-VTI1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VTI1A antibody: synthetic peptide directed towards the N terminal of human VTI1A. Synthetic peptide located within the following region: SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL |
Rabbit Polyclonal Anti-STX1A Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | STX1A / Syntaxin 1A antibody was raised against synthetic 16 amino acid peptide from internal region of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Pig, Opossum, Turkey, Chicken (100%); Horse, Xenopus (94%); Gibbon, Sheep, Zebra finch, Salmon, Stickleback, Pufferfish, Zebrafish, Ant, Water flea (88%); Beetle (81%). |
Rabbit Polyclonal Anti-VAMP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN |
Rabbit Polyclonal Anti-VAMP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VAMP7 antibody: synthetic peptide directed towards the N terminal of human VAMP7. Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK |
Rabbit Polyclonal Anti-GOSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOSR1 antibody: synthetic peptide directed towards the C terminal of human GOSR1. Synthetic peptide located within the following region: IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH |
Rabbit Polyclonal Anti-SNAP29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAP29 antibody: synthetic peptide directed towards the middle region of human SNAP29. Synthetic peptide located within the following region: QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP |
Rabbit Polyclonal Anti-STX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX4 antibody: synthetic peptide directed towards the C terminal of human STX4. Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV |
Rabbit Polyclonal Anti-STX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX4 antibody: synthetic peptide directed towards the middle region of human STX4. Synthetic peptide located within the following region: LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE |
Rabbit Polyclonal Anti-STX7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX7 antibody: synthetic peptide directed towards the N terminal of human STX7. Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS |
Active filters
Reactivities
- Human
Pathways
- SNARE interactions in vesicular transport
Filter by
Category
Target Symbol
- SNAP25 (51)
- BNIP1 (38)
- STX1A (28)
- STX18 (26)
- STX3 (21)
- VTI1A (13)
- VAMP5 (7)
- STX11 (4)
- USE1 (4)
- SNAP23 (3)
- STX4 (3)
- VTI1B (3)
- SNAP29 (2)
- SNAP47 (2)
- STX16 (2)
- STX19 (2)
- STX6 (2)
- STX7 (2)
- STX8 (2)
- VAMP1 (2)
- VAMP7 (2)
- GOSR1 (1)
- GOSR2 (1)
- SEC22B (1)
- STX10 (1)
- STX12 (1)
- STX1B (1)
- STX2 (1)
- STX5 (1)
- VAMP2 (1)
- VAMP4 (1)
- VAMP8 (1)