Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Anti-ACAA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1. |
Rabbit Polyclonal Anti-OXCT1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the middle region of human OXCT1. Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN |
Rabbit anti-ACADM Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACADM |
Rabbit Polyclonal Antibody against ALDH2 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit Polyclonal Anti-ERAB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERAB Antibody: Peptide sequence around aa.253~257(L-D-G-A-I)derived from Human ERAB. |
Rabbit Polyclonal Antibody against ALDH2 (N-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2. |
Rabbit Polyclonal Antibody against ALDH6A1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1. |
Rabbit polyclonal anti-HIBADH antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human HIBADH. |
Rabbit anti-ACAT2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Murine, Rat, Porcine, Ovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT 2 |
Rabbit polyclonal anti-ACADSB antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 399 of mouse ACADSB |
Rabbit Polyclonal Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 293 of the human Pyruvate Dehydrogenase E1-alpha subunit protein. [Swiss-Prot #P08559] |
Goat Polyclonal Antibody against HADH / HADHSC
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YERGDASKEDID, from the internal region of the protein sequence according to NP_005318.2. |
Goat Polyclonal Antibody against HADH2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CIRLDGAIRMQP, from the C Terminus of the protein sequence according to NP_004484. |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Goat Anti-ACAT1 (aa253-266) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEEYKRVDFSKVPK, from the internal region of the protein sequence according to NP_000010.1. |
Goat Anti-ALDH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3. |
Rabbit polyclonal anti-ERAB/HCD2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 250 of rat ERAB/HCD2 |
Rabbit polyclonal anti-TFP1/HADHA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 750 of human TFP1 |
Anti-PDHA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 30-390 amino acids of human pyruvate dehydrogenase (lipoamide) alpha 1 |
Rabbit Polyclonal Anti-Hmgcl Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL |
Mouse Monoclonal ALDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Hamster |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSD17B10 mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
