Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV |
Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1. |
Rabbit anti-ACADM Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACADM |
Rabbit anti-PCCB Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCCB |
Rabbit Polyclonal Antibody against ALDH2 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit Polyclonal Anti-ERAB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERAB Antibody: Peptide sequence around aa.253~257(L-D-G-A-I)derived from Human ERAB. |
Rabbit Polyclonal Antibody against ALDH2 (N-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2. |
Rabbit Polyclonal antibody to BCAT2 (branched chain aminotransferase 2, mitochondrial)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 332 of BCAT2 (Uniprot ID#O15382) |
Rabbit Polyclonal antibody to IVD (isovaleryl Coenzyme A dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 222 of IVD (Uniprot ID#P26440) |
Rabbit polyclonal anti-HIBADH antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human HIBADH. |
Rabbit Polyclonal Aldh3A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2. |
Rabbit polyclonal antibody to ACAD8 (acyl-Coenzyme A dehydrogenase family, member 8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 415 of ACAD8 (Uniprot ID#Q9UKU7) |
Rabbit polyclonal anti-ACADSB antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 399 of mouse ACADSB |
Goat Polyclonal Antibody against HADH / HADHSC
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YERGDASKEDID, from the internal region of the protein sequence according to NP_005318.2. |
Goat Polyclonal Antibody against HADH2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CIRLDGAIRMQP, from the C Terminus of the protein sequence according to NP_004484. |
Rabbit anti-HADH2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human HADH2. |
Goat Anti-ACAT1 (aa253-266) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEEYKRVDFSKVPK, from the internal region of the protein sequence according to NP_000010.1. |
Goat Anti-ALDH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3. |
Rabbit polyclonal anti-ERAB/HCD2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 250 of rat ERAB/HCD2 |
Rabbit polyclonal anti-TFP1/HADHA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 750 of human TFP1 |
Anti-HADH Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal Anti-Mut Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mut antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mut. Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP |
Mouse Monoclonal ALDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Hamster |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSD17B10 mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Pathways
- leucine and isoleucine degradation
Filter by
Category
Target Symbol
- ABAT (60)
- ACAT2 (55)
- HADH (51)
- ACAA2 (42)
- DLD (37)
- HSD17B10 (26)
- ACADM (16)
- IVD (16)
- ALDH2 (11)
- ALDH7A1 (10)
- PCCA (10)
- ACADS (7)
- HADHA (7)
- BCAT1 (6)
- ACAA1 (5)
- DBT (5)
- ALDH9A1 (4)
- AOX1 (4)
- ACAD8 (3)
- ACAT1 (3)
- ALDH6A1 (3)
- BCAT2 (2)
- HIBADH (2)
- PCCB (2)
- ACADSB (1)
- ALDH1B1 (1)
- ALDH3A2 (1)
- ECHS1 (1)
- EHHADH (1)
- HMGCL (1)
- MMUT (1)
- OXCT1 (1)