Germany
Japan
United Kingdom
China
Antibodies
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
.jpg?d=110x100 "User supplied image")
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GFAP Capture mouse monoclonal antibody, Luminex validated, clone OTI4D11
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700041 |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 488 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 488 |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Active filters
Reactivities
- Mouse
Filter by
Target Symbol
- ALK (276)
- VSNL1 (274)
- MAP2K1 (241)
- ERBB2 (223)
- JUN (190)
- NME1 (168)
- ABCB1 (167)
- EGFR (160)
- ERCC1 (158)
- MAP2K3 (157)
- CTNNB1 (154)
- GLI1 (154)
- GADD45G (134)
- OTC (132)
- VIM (132)
- AKT1 (130)
- PCNA (119)
- NUMB (112)
- PIK3C2A (112)
- APP (111)
- BRAF (101)
- LGALS3 (101)
- MAPK13 (100)
- TOP2A (99)
- UBE2E3 (97)
- SENP2 (95)
- L1CAM (93)
- F13A1 (91)
- TYMS (88)
- NKX2-1 (87)
- PNMT (87)
- BCL2 (84)
- MIEN1 (84)
- MLH1 (83)
- MAPK1 (82)
- STAT5A (82)
- LGR5 (80)
- PDCD1 (80)
- GFAP (79)
- ALDH1L1 (78)
- LOX (76)
- SQSTM1 (75)
- MTOR (74)
- UBA52 (74)
- MAPT (72)
- SPG7 (72)
- STAT4 (71)
- BCL10 (70)
- BTK (70)
- CNOT4 (70)
- MEF2C (70)
- NCAM1 (70)
- PARVA (70)
- SNAI2 (70)
- AFAP1 (69)
- LTA4H (69)
- PTPRE (68)
- CBX8 (67)
- CDK2 (67)
- NR3C1 (67)
- FOS (66)
- EFNA2 (64)
- PIK3CG (64)
- TLE1 (64)
- FSHB (63)
- LPL (63)
- PIK3AP1 (63)
- PRKCE (63)
- RB1 (63)
- RNF144B (63)
- SMS (63)
- ESR1 (62)
- LDLRAP1 (62)
- PSMC3 (62)
- SOCS3 (62)
- ZFP36 (62)
- ABAT (61)
- BECN1 (61)
- CRYAB (61)
- FGFR2 (61)
- LIMK1 (61)
- MIOX (61)
- PSMD2 (61)
- SYP (61)
- TNNI3 (61)
- BBOX1 (60)
- FOXO1 (60)
- MCM2 (60)
- KRAS (59)
- MAPK7 (59)
- NRBF2 (59)
- RRM1 (59)
- UNG (59)
- VBP1 (59)
- ACAT2 (58)
- ERG (58)
- MOB3B (58)
- MSI1 (58)
- NPR3 (58)
- PCDH7 (58)
Applications
Antibody Hosts
Isotypes
- IgG (32033)
- IgG1 (25024)
- IgG2a (7098)
- IgG2b (6124)
- IgG1, kappa (177)
- IgG3 (136)
- Ig (124)
- IgG, kappa (112)
- IgG2a, kappa (75)
- IgY (49)
- IgG2b, kappa (43)
- IgM (36)
- IgG1, lambda (15)
- IgG2c (11)
- IgG2a, lambda (6)
- IgM, kappa (4)
- IgA (1)
- IgA, kappa (1)
- IgG12b (1)
- IgG2, kappa (1)
- IgG2b, lambda (1)
- IgG3, kappa (1)
- IgG3/IgG1 (1)
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (7652)
- Phospho-specific (1159)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (34)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (16)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (16)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (13)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (8)
- Acetyl K5 (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (4)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (4)
- Modification (3)
- Phospho S166 (3)
- Phospho S376 (3)
- Phospho S83 (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG2 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- MonoMethyl K342 (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S128 (2)
- Phospho S15 (2)
- Phospho S16 (2)
- Phospho S319 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S727 (2)
- Phospho S89 (2)
- Phospho T187 (2)
- Phospho T286 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- Phospho Y410 (2)
- This chimeric hamster (Armenian) antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric mouse antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (2)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (2)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K29 (1)
- Acetyl K332 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho 180/Y182,Phospho T180/Y182,Phospho T180/Y182,Phospho T183/Y1845 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S1033 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S129 (1)
- Phospho S1387 (1)
- Phospho S139 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S176/180 (1)
- Phospho S180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S1943 (1)
- Phospho S1981 (1)
- Phospho S199/S204 (1)
- Phospho S20 (1)
- Phospho S2056 (1)
- Phospho S209 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S235/236 (1)
- Phospho S240/244 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S2481 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S259 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S291 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S304 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S32 (1)
- Phospho S323 (1)
- Phospho S33 (1)
- Phospho S33/S37/T41 (1)
- Phospho S330 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S345 (1)
- Phospho S36 (1)
- Phospho S365 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S396 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S465/S467 (1)
- Phospho S467 (1)
- Phospho S471/472 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S519/T522 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S612 (1)
- Phospho S616 (1)
- Phospho S62 (1)
- Phospho S637 (1)
- Phospho S638 (1)
- Phospho S641 (1)
- Phospho S643/676 (1)
- Phospho S645 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S7 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S795 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S9 (1)
- Phospho S916 (1)
- Phospho S957 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser792 (1)
- Phospho Ser90 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T1462 (1)
- Phospho T156 (1)
- Phospho T163 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T181 (1)
- Phospho T183/T172 (1)
- Phospho T183/Y185 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T204 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T231 (1)
- Phospho T231/S232 (1)
- Phospho T232 (1)
- Phospho T235 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T246 (1)
- Phospho T261 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T346 (1)
- Phospho T357/S358/S360 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T434 (1)
- Phospho T446 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T56 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T642 (1)
- Phospho T668 (1)
- Phospho T678 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T70 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T93 (1)
- Phospho T982 (1)
- Phospho Thr212/Ser214 (1)
- Phospho Thr421 (1)
- Phospho Y10 (1)
- Phospho Y1007 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1021 (1)
- Phospho Y1022/1023 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1068 (1)
- Phospho Y1070 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1217 (1)
- Phospho Y1284 (1)
- Phospho Y133 (1)
- Phospho Y138 (1)
- Phospho Y139 (1)
- Phospho Y14 (1)
- Phospho Y145 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y177 (1)
- Phospho Y182 (1)
- Phospho Y191 (1)
- Phospho Y204 (1)
- Phospho Y207 (1)
- Phospho Y221 (1)
- Phospho Y245 (1)
- Phospho Y307 (1)
- Phospho Y311 (1)
- Phospho Y322 (1)
- Phospho Y340 (1)
- Phospho Y397 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y564 (1)
- Phospho Y653 (1)
- Phospho Y659 (1)
- Phospho Y694 (1)
- Phospho Y705 (1)
- Phospho Y719 (1)
- Phospho Y724 (1)
- Phospho Y751 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y869 (1)
- Phospho Y980/981 (1)
- Phospho Y992 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Phospho-RPS6KB1-S371 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric antibody created to reduce immunogenicity during in vivo applications. (1)
- This is a chimeric mouse antibody, based on the original hamster IgG format, created for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- Ubiquityl K119 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
- monoMethyl E105 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- phospho S76 (1)
- succinylation K79 (1)
Assay Types
Assay Platforms
Families
- Druggable Genome (33387)
- Transcription Factors (10040)
- Transmembrane (8234)
- Protein Kinase (5157)
- ES Cell Differentiation/IPS (3988)
- Secreted Protein (2880)
- Stem cell - Pluripotency (2428)
- Protease (2224)
- Adult stem cells (963)
- Nuclear Hormone Receptor (826)
- Phosphatase (732)
- Embryonic stem cells (691)
- GPCR (682)
- Cancer stem cells (624)
- Stem cell relevant signaling - JAK/STAT signaling pathway (503)
- Stem cell relevant signaling - DSL/Notch pathway (393)
- Ion Channels: Other (324)
- Induced pluripotent stem cells (323)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (241)
- Ion Channels: Potassium (145)
- P450 (128)
- Stem cell relevant signaling - Wnt Signaling pathway (126)
- Ion Channels: Cys-loop Receptors (78)
- Ion Channels: Glutamate Receptors (69)
- Ion Channels: Transient receptor potential (68)
- Ion Channels: Sodium (25)
- Ion Channels: Cyclic nucleotide gated (15)
- Ion Channels: Calcium (8)
- Ion Channels: ATP Receptors (6)
Pathways
- Metabolic pathways (5282)
- Pathways in cancer (4985)
- MAPK signaling pathway (3582)
- Focal adhesion (2965)
- Prostate cancer (2472)
- Neurotrophin signaling pathway (2329)
- Colorectal cancer (2277)
- ErbB signaling pathway (2245)
- Regulation of actin cytoskeleton (2004)
- Pancreatic cancer (1914)
- Insulin signaling pathway (1913)
- T cell receptor signaling pathway (1887)
- Endometrial cancer (1791)
- Toll-like receptor signaling pathway (1728)
- Progesterone-mediated oocyte maturation (1711)
- B cell receptor signaling pathway (1706)
- Chronic myeloid leukemia (1701)
- Non-small cell lung cancer (1666)
- Chemokine signaling pathway (1652)
- Melanoma (1615)
- Glioma (1594)
- GnRH signaling pathway (1590)
- Acute myeloid leukemia (1552)
- Renal cell carcinoma (1542)
- Fc epsilon RI signaling pathway (1526)
- Cell cycle (1458)
- Wnt signaling pathway (1392)
- Endocytosis (1349)
- VEGF signaling pathway (1338)
- Bladder cancer (1321)
- Adherens junction (1230)
- Leukocyte transendothelial migration (1230)
- Fc gamma R-mediated phagocytosis (1215)
- Small cell lung cancer (1203)
- Gap junction (1194)
- Natural killer cell mediated cytotoxicity (1161)
- Alzheimer's disease (1120)
- Calcium signaling pathway (1071)
- Apoptosis (1063)
- Jak-STAT signaling pathway (1052)
- Oocyte meiosis (1046)
- Purine metabolism (1044)
- Epithelial cell signaling in Helicobacter pylori infection (1041)
- Melanogenesis (1008)
- Axon guidance (997)
- Tight junction (975)
- mTOR signaling pathway (958)
- Cytokine-cytokine receptor interaction (952)
- Long-term potentiation (905)
- Adipocytokine signaling pathway (901)
- Ubiquitin mediated proteolysis (901)
- Thyroid cancer (858)
- Huntington's disease (857)
- Amyotrophic lateral sclerosis (ALS) (849)
- Long-term depression (842)
- Vascular smooth muscle contraction (828)
- Type II diabetes mellitus (781)
- Pyrimidine metabolism (751)
- Neuroactive ligand-receptor interaction (741)
- p53 signaling pathway (740)
- TGF-beta signaling pathway (736)
- Pathogenic Escherichia coli infection (680)
- Glycolysis / Gluconeogenesis (655)
- Basal cell carcinoma (653)
- NOD-like receptor signaling pathway (629)
- Parkinson's disease (614)
- Cell adhesion molecules (CAMs) (608)
- Dorso-ventral axis formation (597)
- Nucleotide excision repair (597)
- Arginine and proline metabolism (583)
- Hedgehog signaling pathway (580)
- Prion diseases (572)
- RIG-I-like receptor signaling pathway (505)
- Hypertrophic cardiomyopathy (HCM) (503)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (499)
- Dilated cardiomyopathy (482)
- Proteasome (470)
- Phosphatidylinositol signaling system (456)
- Spliceosome (424)
- RNA degradation (421)
- Oxidative phosphorylation (419)
- Valine (414)
- Inositol phosphate metabolism (412)
- Notch signaling pathway (412)
- leucine and isoleucine degradation (395)
- Alanine (356)
- aspartate and glutamate metabolism (356)
- Mismatch repair (355)
- DNA replication (353)
- Pyruvate metabolism (347)
- Antigen processing and presentation (336)
- Base excision repair (336)
- Tyrosine metabolism (335)
- Vibrio cholerae infection (321)
- PPAR signaling pathway (318)
- Fatty acid metabolism (314)
- Butanoate metabolism (301)
- ABC transporters (298)
- Primary immunodeficiency (295)
- Lysine degradation (293)
- One carbon pool by folate (278)
- Viral myocarditis (275)
- Propanoate metabolism (273)
- Glutathione metabolism (264)
- Maturity onset diabetes of the young (262)
- Cardiac muscle contraction (254)
- Glycine (251)
- serine and threonine metabolism (251)
- Arachidonic acid metabolism (242)
- Hematopoietic cell lineage (240)
- Tryptophan metabolism (233)
- Cytosolic DNA-sensing pathway (230)
- ECM-receptor interaction (223)
- Lysosome (219)
- Systemic lupus erythematosus (219)
- Citrate cycle (TCA cycle) (218)
- Histidine metabolism (216)
- Complement and coagulation cascades (212)
- beta-Alanine metabolism (205)
- Cysteine and methionine metabolism (202)
- Ribosome (202)
- Glycerolipid metabolism (200)
- SNARE interactions in vesicular transport (196)
- Drug metabolism - cytochrome P450 (185)
- Amino sugar and nucleotide sugar metabolism (179)
- Fructose and mannose metabolism (178)
- Porphyrin and chlorophyll metabolism (171)
- Starch and sucrose metabolism (171)
- Pentose phosphate pathway (170)
- Regulation of autophagy (169)
- Metabolism of xenobiotics by cytochrome P450 (162)
- Retinol metabolism (155)
- Drug metabolism - other enzymes (152)
- Circadian rhythm - mammal (146)
- Type I diabetes mellitus (136)
- Terpenoid backbone biosynthesis (134)
- RNA polymerase (127)
- Renin-angiotensin system (126)
- Methane metabolism (125)
- Fatty acid elongation in mitochondria (117)
- Galactose metabolism (114)
- Olfactory transduction (109)
- Glyoxylate and dicarboxylate metabolism (107)
- Glycerophospholipid metabolism (105)
- Nicotinate and nicotinamide metabolism (105)
- Nitrogen metabolism (105)
- Basal transcription factors (103)
- N-Glycan biosynthesis (103)
- Homologous recombination (101)
- Ascorbate and aldarate metabolism (99)
- Selenoamino acid metabolism (99)
- Phenylalanine metabolism (90)
- Ether lipid metabolism (78)
- Androgen and estrogen metabolism (77)
- Synthesis and degradation of ketone bodies (77)
- Folate biosynthesis (75)
- Sphingolipid metabolism (72)
- Taste transduction (62)
- Non-homologous end-joining (57)
- Sulfur metabolism (56)
- Primary bile acid biosynthesis (54)
- Allograft rejection (50)
- Autoimmune thyroid disease (50)
- Graft-versus-host disease (50)
- Pantothenate and CoA biosynthesis (49)
- Aminoacyl-tRNA biosynthesis (48)
- Riboflavin metabolism (47)
- Other glycan degradation (46)
- Caffeine metabolism (42)
- Taurine and hypotaurine metabolism (39)
- Limonene and pinene degradation (37)
- Cyanoamino acid metabolism (36)
- Vitamin B6 metabolism (36)
- Glycosaminoglycan degradation (35)
- Thiamine metabolism (34)
- Glycosphingolipid biosynthesis - lacto and neolacto series (32)
- Linoleic acid metabolism (31)
- Fatty acid biosynthesis (30)
- Keratan sulfate biosynthesis (30)
- Biosynthesis of unsaturated fatty acids (29)
- leucine and isoleucine biosynthesis (27)
- Pentose and glucuronate interconversions (24)
- alpha-Linolenic acid metabolism (24)
- O-Glycan biosynthesis (22)
- Phenylalanine (22)
- tyrosine and tryptophan biosynthesis (22)
- D-Glutamine and D-glutamate metabolism (20)
- Asthma (19)
- Steroid biosynthesis (19)
- Protein export (13)
- Glycosphingolipid biosynthesis - ganglio series (11)
- Heparan sulfate biosynthesis (10)
- Chondroitin sulfate biosynthesis (9)
- Ubiquinone and other terpenoid-quinone biosynthesis (6)
- C21-Steroid hormone metabolism (5)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (4)
- Glycosphingolipid biosynthesis - globo series (3)
- Lysine biosynthesis (3)
- D-Arginine and D-ornithine metabolism (1)
- Lipoic acid metabolism (1)
- O-Mannosyl glycan biosynthesis (1)