Germany
Japan
United Kingdom
China
ALX4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ALX4 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ALX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSA |
Rabbit Polyclonal Anti-ALX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALX4 Antibody: synthetic peptide directed towards the middle region of human ALX4. Synthetic peptide located within the following region: GQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISW |
Rabbit Polyclonal Anti-ALX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALX4 Antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSA |
Rabbit Polyclonal Anti-ALX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: SSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESG |
Rabbit Polyclonal Anti-ALX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the C terminal of human ALX4. Synthetic peptide located within the following region: SVSGAGSHVGQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKA |
Rabbit Polyclonal Anti-Alx4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Alx4 antibody: synthetic peptide directed towards the middle region of mouse Alx4. Synthetic peptide located within the following region: EPELPPDSEPVGMDNSYLSVKETGAKGPQDRASAEIPSPLEKTDSESNKG |
Rabbit Polyclonal Anti-ALX4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ALX4 |
ALX4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ALX4 |
ALX4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ALX4 (NP_068745.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ALX4