Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Collagen V (COL5A1) goat polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Human type V collagen |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Chicken |
| Immunogen | Purified collagen type IV from chicken skin |
Col5a1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Mouse, Rat |
| Immunogen | Purified collagen type V from Rat skin. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified collagen type V from Human placenta |
Collagen V (COL5A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Biotin |
| Immunogen | Collagen Type V from Human and Bovine placenta. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit Polyclonal Anti-Collagen Valpha 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Collagen Valpha 1 Antibody: A synthesized peptide derived from human Collagen Valpha 1 |
Anti-COL5A1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 69-82 amino acids of human collagen, type V, alpha 1 |
Col5a1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF |
| Reactivities | Rat |
| Immunogen | Collagen type V extracted and purified from rat skin. |
Rabbit Polyclonal Anti-COL5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL5A1 antibody: synthetic peptide directed towards the N terminal of human COL5A1. Synthetic peptide located within the following region: PGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPG |
COL5A1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human COL5A1 |
Active filters
Target Symbol
- COL5A1