Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Histone H3 (Ab-28) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P). |
Rabbit polyclonal anti-Histone H3.1 (Ser10) antibody (Phospho-specific)
| Applications | IHC, WB |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histone H3.1 around the phosphorylation site of serine 10 (R-K-SP-T-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal Histone H3 (Ab-3) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of threonine 3 (A-R-TP-K-Q). |
Rabbit polyclonal Histone H3 (Thr3) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histone H3 around the phosphorylation site of threonine 3 (A-R-TP-K-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal Histone H3 (Ser28) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Histone H3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Histone-3 was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to the c-terminus region of human histone-3. |
Anti-HIST1H3A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (KLH-coupled) derived from human HIST1H3A |
Rabbit Polyclonal Anti-HIST1H3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIST1H3A antibody: synthetic peptide directed towards the N terminal of human HIST1H3A. Synthetic peptide located within the following region: KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR |
Mouse Monoclonal H3K36me2 Antibody
| Applications | ELISA |
| Reactivities | Human |
Rabbit anti Histone H3((Monomethylation at Lys4) Polyclonal Antibody
| Applications | IP |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Histone H3(Monomethylation at Lys9) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing AR[Me1-K]ST in which Me2-K corresponds to Monomethyl lysine 9 of human histone H3. |
Rabbit anti Monomethyl-Histone H3(Lys27) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing KAAR[Me1-K]SAP in which Me1-K corresponds to Monomethyl lysine 27 of human histone H3. |
Rabbit anti Histone H3(Dimethylation at Lys4) Polyclonal Antibody
| Applications | IP |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing RT[Me2-K]QT in which Me2-K corresponds to dimethyl lysine 4 of human histone H3. |
Rabbit anti Histone H3 (pSer10) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing -QTARKSTGGKA-with phosphorylated serine 10 of human Histone H3. |
Rabbit anti Histone H3 Polyclonal Antibody
| Applications | IP |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within ~100 amino acids from N-terminus of human histone H3. |
Rabbit anti Histone H3 (Acetylation at K4) Polyclonal Antibody
| Applications | Dot |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing ART[Acetyl-K]QTAR in which Acetylation site is located at lysine 4 of human histone H3. |
Rabbit anti Histone H3 (Acetylation at K9) Polyclonal Antibody
| Applications | Dot |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing TAR[Acetyl-K]STGG in which Acetylation at lysine 9 of human histone H3 |
Rabbit anti Histone H3 (Citrulline at N-term) Polyclonal Antibody
| Applications | IF |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing N-terminus of human histone H3 with citrulline modification at 2/8/17. |
Active filters
Target Symbol
- HIST1H3A