Germany
Japan
United Kingdom
China
Antibodies
View as table Download
RRM2 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human RRM2 |
Rabbit Polyclonal Anti-RRM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RRM2 antibody: synthetic peptide directed towards the N terminal of human RRM2. Synthetic peptide located within the following region: PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP |
RRM2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RRM2 |
RRM2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RRM2 |
RRM2 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human RRM2 |
Active filters
Target Symbol
- RRM2