Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal PD-L1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
CASP8 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CASP8 |
CD274 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD274 |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
CD274 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD274 |
HLA-A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HLA-A |
Rabbit Polyclonal PDL-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PDL-2 antibody was raised against a 16 amino acid peptide from near the center of human PDL-2. |
Rabbit Monoclonal Antibody against TTR (Clone EP2929Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Caspase-8 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Caspase-8 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-8 isoform A. |
Rabbit polyclonal TGFBR2 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit monoclonal antibody against Prealbumin(clone EPR2928(2))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-HER3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HER3. |
Rabbit polyclonal CASP8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
CASP8AP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CASP8AP2 |
KRAS rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KRAS |
Rabbit Polyclonal FLIP Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | FLIP antibody was raised against a peptide corresponding to amino acids near the C-terminus of human FLIPaFLIPl form. The immunogen is located within the last 50 amino acids of FLIP. |
Rabbit Polyclonal FLASH Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | FLASH antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy-terminus of human FLASH which differ from those of mouse by one amino acid. |
Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
Rabbit monoclonal antibody against HER3/ErbB3 Phospho (pY1289) (EPR2325 ) (phospho-specific)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit Polyclonal FLIP Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | FLIP antibody was raised against a 19 amino acid peptide near the carboxy terminus of human FLIP. The immunogen is located within amino acids 180 - 230 of FLIP. |
Rabbit polyclonal anti-HER3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3. |
Rabbit polyclonal Caspase 8 (Tyr380) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 8 around the phosphorylation site of tyrosine 380 (Q-P-YP-L-E). |
Modifications | Phospho-specific |
Rabbit polyclonal PTEN (Ab-370) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370. |
Rabbit polyclonal anti-MED1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MED1. |
Rabbit polyclonal TTR Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR. |
Rabbit Polyclonal Caspase 8 (Ser347) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 around the phosphorylation site of Serine 347 |
Modifications | Phospho-specific |
HLA-A/B/C rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HLA-A/B/C |
CD274 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD274 |
CD274 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD274 |
Rabbit Polyclonal ErbB3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. In vivo generated recombinant protein fragment |
Rabbit Polyclonal FLIP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | FLIP antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human FLIP. The sequence is identical in all FLIP splice variants. The immunogen is located within the first 50 amino acids of FLIP. |
Rabbit polyclonal antibody to DEDD (death effector domain containing)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 129 and 223 of DEDD (Uniprot ID#O75618) |
Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CASP8. |
Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I). |
Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 8 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 |
Rabbit Polyclonal PPAR-BP Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP |
Rabbit Polyclonal PPAR-BP (Thr1457) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP around the phosphorylation site of Threonine 1457 |
Modifications | Phospho-specific |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
Modifications | Phospho-specific |
Rabbit Polyclonal PTEN Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Rabbit Polyclonal Anti-ANXA2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS |
Rabbit Polyclonal Caspase 8 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal PTEN Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | PTEN antibody was raised against a 15 amino acid peptide from near the amino terminus of human PTEN. |