Germany
Japan
United Kingdom
China
MBD4 (Myc-DDK-tagged)-Human methyl-CpG binding domain protein 4 (MBD4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Antibody Sample
View as table Download
Lenti ORF particles, MBD4 (Myc-DDK-tagged)-Human methyl-CpG binding domain protein 4 (MBD4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, MBD4 (mGFP-tagged)-Human methyl-CpG binding domain protein 4 (MBD4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Mbd4 (GFP-tagged) - Mouse methyl-CpG binding domain protein 4 (Mbd4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 (GFP-tagged) - Human methyl-CpG binding domain protein 4 (MBD4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mbd4 (Myc-DDK-tagged) - Mouse methyl-CpG binding domain protein 4 (Mbd4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN423909 is the updated version of KN223909.
Mbd4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509835 is the updated version of KN309835.
Lenti ORF clone of Mbd4 (Myc-DDK-tagged) - Mouse methyl-CpG binding domain protein 4 (Mbd4)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mbd4 (Myc-DDK-tagged) - Mouse methyl-CpG binding domain protein 4 (Mbd4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF clone of Mbd4 (mGFP-tagged) - Mouse methyl-CpG binding domain protein 4 (Mbd4)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mbd4 (GFP-tagged) - Mouse methyl-CpG binding domain protein 4 (Mbd4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti-ORF clone of MBD4 (Myc-DDK-tagged)-Human methyl-CpG binding domain protein 4 (MBD4)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MBD4 (Myc-DDK-tagged)-Human methyl-CpG binding domain protein 4 (MBD4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti-ORF clone of MBD4 (mGFP-tagged)-Human methyl-CpG binding domain protein 4 (MBD4)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MBD4 (mGFP-tagged)-Human methyl-CpG binding domain protein 4 (MBD4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
MBD4 (Myc-DDK tagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 (Myc-DDK tagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 (Myc-DDK tagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 (Myc-DDK tagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 (GFP-tagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 (GFP-tagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 (GFP-tagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 (GFP-tagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MBD4 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
MBD4 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Mbd4 (untagged) - Mouse methyl-CpG binding domain protein 4 (cDNA clone MGC:36060 IMAGE:5356016), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MBD4 (mGFP-tagged)-Human methyl-CpG binding domain protein 4 (MBD4)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MBD4 (untagged)-Human methyl-CpG binding domain protein 4 (MBD4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Mbd4 - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
MBD4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of methyl-CpG binding domain protein 4 (MBD4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-MBD4 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT |
MBD4 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
MBD4 CRISPRa kit - CRISPR gene activation of human methyl-CpG binding domain 4, DNA glycosylase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Mbd4 CRISPRa kit - CRISPR gene activation of mouse methyl-CpG binding domain protein 4
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene MBD4
qSTAR qPCR primer pairs against Mus musculus gene Mbd4
3`UTR clone of methyl-CpG binding domain protein 4 (MBD4) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
MBD4 (untagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD4 (untagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD4 (untagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD4 (untagged) - Homo sapiens methyl-CpG binding domain protein 4 (MBD4), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
Mbd4 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
MBD4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MBD4 |
MBD4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MBD4 |
MBD4 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Mbd4 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Mbd4 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- MBD4