Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit polyclonal ITGAX Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGAX antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1119-1145 amino acids from the C-terminal region of human ITGAX. |
Cd7 rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, WB |
| Reactivities | Mouse |
| Immunogen | Synthetic peptides derived from internal part of the murine CD7 protein |
Rabbit Polyclonal antibody to CD55 (CD55 molecule, decay accelerating factor for complement (Cromer blood group))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 71 and 330 of CD55 (Uniprot ID#P08174) |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit polyclonal MME Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME. |
Rabbit Polyclonal Anti-ITGA2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal CD18/ITGB2 (Thr758) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD18/ITGB2 around the phosphorylation site of threonine 758 (S-A-TP-T-T). |
| Modifications | Phospho-specific |
Rabbit anti-FLT3 polyclonal antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman FLT3 around the phosphorylation site of tyrosine 591 (Y-F-YP-V-D). |
CD163 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 750-1050 of human CD163 (NP_004235.4). |
| Modifications | Unmodified |
CD34 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CD34 (NP_001020280.1). |
| Modifications | Unmodified |
CD34 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-320 of human CD34 (NP_001020280). |
| Modifications | Unmodified |
CD38 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 46-300 of human CD38 (NP_001766.2). |
| Modifications | Unmodified |
CD38 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human CD38 (NP_001766.2). |
| Modifications | Unmodified |
CD3D Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-105 of human CD3D (NP_000723.1). |
| Modifications | Unmodified |
CD3E Antigen Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CD3E Antigen (NP_000724.1). |
| Modifications | Unmodified |
CD44 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 148-247 of human CD44 (NP_001189486.1). |
| Modifications | Unmodified |
CD44 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 346-385 of human CD44 (NP_000601.3). |
CD68 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-319 of human CD68 (NP_001242.2). |
| Modifications | Unmodified |
CD68 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-200 of human CD68 (NP_001242.2). |
| Modifications | Unmodified |
CD68 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-319 of human CD68 (NP_001242.2). |
| Modifications | Unmodified |
FCGR2B Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FCGR2B |
| Modifications | Unmodified |
Integrin alpha 2 (ITGA2/CD49b) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Integrin alpha 2 (ITGA2/CD49b) |
| Modifications | Unmodified |
Integrin alpha 5 (ITGA5/CD49e) Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 750-1000 of human Integrin alpha 5 (ITGA5/CD49e) (NP_002196.4). |
| Modifications | Unmodified |
CD11b/ITGAM Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-330 of human CD11b/ITGAM (NP_001139280.1). |
| Modifications | Unmodified |
CD117/c-Kit Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-295 of human CD117/c-Kit (NP_000213.1). |
| Modifications | Unmodified |
NCAM1 / CD56 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NCAM1 / CD56 |
| Modifications | Unmodified |
NCAM1 / CD56 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2). |
| Modifications | Unmodified |
CD45 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1057-1306 of human CD45 (NP_002829.3). |
| Modifications | Unmodified |
Siglec-15 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Siglec-15. |
CD3 zeta Rabbit polyclonal Antibody
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human CD3 zeta |
CD44 Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CD44. AA range:681-730 |
Recombinant Anti-CD16/CD32 (Clone 2.4G2)
| Applications | FC, IF, IHC, IP |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
USD 523.00
2 Weeks
Recombinant Anti-CD11b (Clone 5C6 (recombinant version))
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD3 epsilon (Clone YTH 12.5)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
