Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
SARS M (C-term) rabbit polyclonal antibody, Serum
| Applications | EM, IF, IP, WB |
| Immunogen | BSAcoupled Synthetic peptide corresponding to the C-terminus (amino acid residues 204-221) of the SARS Coronavirus Membrane protein |
Rabbit Polyclonal Anti-ACE2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACE2 Antibody: A synthesized peptide |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to amino acids near the center of human ACE2. The immunogen is located within aa 180-230 of ACE2. |
Rabbit Polyclonal Anti-Masp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT |
Rabbit Polyclonal Anti-CD147 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD147 Antibody: A synthesized peptide derived from human CD147 |
SARS N rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Immunogen | Recombinant protein corresponding to full length SARS Coronavirus Nucleocapsid protein |
USD 440.00
2 Weeks
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-SARS Spike Antibody
| Reactivities | Virus |
| Immunogen | SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids near the center of. The sARS Spike glycoprotein. |
Rabbit Polyclonal Anti-SARS Spike Antibody
| Reactivities | Virus |
| Immunogen | SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids near the center of. The sARS Spike glycoprotein. |
Rabbit Polyclonal Anti-SARS Spike Antibody
| Reactivities | Virus |
| Immunogen | SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids near the center of. The sARS Spike glycoprotein. |
Rabbit Polyclonal Anti-SARS Spike Antibody
| Reactivities | Virus |
| Immunogen | SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids at the carboxy terminus of the SARS Spike glycoprotein. |
Rabbit Polyclonal Anti-SARS Matrix Antibody
| Reactivities | Virus |
| Immunogen | SARS matrix antibody was raised against a synthetic peptide corresponding to amino acids at the amino-terminus of the SARS matrix protein. |
Rabbit Polyclonal Anti-SARS Matrix Antibody
| Reactivities | Virus |
| Immunogen | SARS matrix antibody was raised against a synthetic peptide corresponding to 15 amino acids at the carboxy terminus of the SARS matrix protein. |
Rabbit Polyclonal Anti-SARS Envelope Antibody
| Reactivities | Virus |
| Immunogen | SARS envelope antibody was raised against a synthetic peptide corresponding to amino acids at the amino-terminus of the SARS envelope protein. |
Rabbit Polyclonal Anti-SARS Envelope Antibody
| Reactivities | Virus |
| Immunogen | SARS envelope antibody was raised against a synthetic peptide corresponding to amino acids at the carboxy terminus of the SARS envelope protein. |
Germany
Japan
United Kingdom
China
