Germany
Japan
United Kingdom
China
WNT Pathway Markers-Antibodies
View as table Download
Goat Polyclonal Antibody against FZD7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1. |
Rabbit Polyclonal antibody to NULP1 (transcription factor 25 (basic helix-loop-helix))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 427 and 676 of NULP1 (Uniprot ID#Q9BQ70) |
Rabbit polyclonal anti-FZD4 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD4. |
Rabbit polyclonal anti-MAPK10 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK10. |
Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TCF4/12 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF4/12. |
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit polyclonal anti-FZD1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD1. |
Rabbit polyclonal anti-FZD1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD1. |
Rabbit polyclonal anti-FZD8 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD8 |
Rabbit polyclonal anti-FZD9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9. |
Rabbit polyclonal anti-ANAPC5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ANAPC5. |
Anti-TCF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 210 amino acids of human transcription factor 4 |
Anti-WNT5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit polyclonal DVL3 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit polyclonal FZD1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FZD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the Central region of human FZD1. |
Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK2 |
Rabbit polyclonal ROCK2 (Ab-722) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ROCK2 around the phosphorylation site of tyrosine 722 (K-I-YP-E-S). |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP |
Rabbit Polyclonal WNT2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT5B Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Dishevelled 3 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
LEF1 mouse monoclonal antibody, clone 2D12, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
ROCK1 mouse monoclonal antibody, clone 12M03, Purified
| Applications | WB |
| Reactivities | Human |
MEK4 (MAP2K4) mouse monoclonal antibody, clone 2D10D8, Ascites
| Applications | ELISA, IHC |
| Reactivities | Human |
JLP (SPAG9) rabbit polyclonal antibody, Aff - Purified
| Applications | IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide of human JLP (JNK-associated leucinezipper protein 1). |
WNT3A rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
Frizzled homolog 1 (FZD1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 22-76 of Human Frizzled-1. |
FZD3 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200of Human Frizzled-3. |
MEK4 (MAP2K4) pThr261 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
MEK4 (MAP2K4) pThr261 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of threonine261 (A-K-Tp-R-D) |
MEK4 (MAP2K4) pThr261 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of threonine261 (A-K-Tp-R-D) |
MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of threonine 261 (A-K-Tp-R-D). |
MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of threonine 261 (A-K-Tp-R-D). |
Filter by
Category
Target Symbol
- MAPK8 (64)
- WNT3 (47)
- DVL2 (42)
- ANAPC11 (34)
- ROR2 (34)
- ANAPC2 (33)
- MAPK9 (31)
- RORA (28)
- PTK7 (20)
- MAPK10 (19)
- ROCK2 (17)
- LEF1 (15)
- ROR1 (15)
- WNT1 (13)
- FZD4 (11)
- ANAPC5 (10)
- ROCK1 (10)
- WNT2B (10)
- WNT3A (10)
- WNT5B (10)
- LRP6 (9)
- FZD2 (8)
- TCF25 (8)
- WNT10A (8)
- FZD1 (7)
- FZD8 (7)
- FZD9 (7)
- LRP5 (7)
- TCF4 (7)
- TCF7L2 (7)
- WNT16 (7)
- WNT2 (7)
- WNT4 (7)
- WNT6 (7)
- ANAPC10 (6)
- FZD10 (6)
- WNT5A (6)
- WNT9A (6)
- DVL3 (5)
- FZD3 (5)
- FZD5 (5)
- FZD6 (5)
- WNT11 (5)
- ANAPC13 (4)
- TCF21 (4)
- ANAPC15 (3)
- APC2 (3)
- FZD7 (3)
- INTS1 (3)
- WNT7A (3)
- MAP2K4 (2)
- RYK (2)
- SLC25A23 (2)
- WNT7B (2)
- APOC2 (1)
- DVL1 (1)
- JKK-1 (1)
- LRP5L (1)
- MAP2K7 (1)
Reactivities
- Human (589)
- Mouse (488)
- Rat (419)
- Dog (36)
- Monkey (34)
- Bovine (23)
- Chicken (12)
- Rabbit (12)
- Hamster (11)
- Gorilla (10)
- Bat (9)
- Horse (9)
- Gibbon (8)
- Pig (7)
- Canis (5)
- Primate (3)
- Xenopus (3)
- Guinea Pig (2)
- C. elegans (1)
- Canine (1)
- Chimpanzee (1)
- Cow (1)
- Frog (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Sheep (1)
- Tobacco hornworm (1)
Antibody Hosts
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (503)
- Transmembrane (222)
- Protein Kinase (192)
- ES Cell Differentiation/IPS (176)
- Secreted Protein (125)
- Transcription Factors (48)
- Adult stem cells (45)
- GPCR (44)
- Cancer stem cells (34)
- Stem cell relevant signaling - Wnt Signaling pathway (34)
- Nuclear Hormone Receptor (26)
- Induced pluripotent stem cells (8)
Pathways
- Wnt signaling pathway (372)
- Pathways in cancer (340)
- Basal cell carcinoma (238)
- Melanogenesis (235)
- Colorectal cancer (215)
- Progesterone-mediated oocyte maturation (180)
- Hedgehog signaling pathway (125)
- Focal adhesion (123)
- ErbB signaling pathway (105)
- Fc epsilon RI signaling pathway (105)
- GnRH signaling pathway (105)
- MAPK signaling pathway (105)
- Toll-like receptor signaling pathway (105)
- Epithelial cell signaling in Helicobacter pylori infection (104)
- Neurotrophin signaling pathway (103)
- Adipocytokine signaling pathway (102)
- Insulin signaling pathway (102)
- NOD-like receptor signaling pathway (102)
- Pancreatic cancer (102)
- RIG-I-like receptor signaling pathway (102)
- Type II diabetes mellitus (102)
- Cell cycle (78)
- Oocyte meiosis (78)
- Ubiquitin mediated proteolysis (78)
- Notch signaling pathway (43)
- T cell receptor signaling pathway (31)
- Regulation of actin cytoskeleton (24)
- Axon guidance (21)
- Chemokine signaling pathway (21)
- Leukocyte transendothelial migration (21)
- Pathogenic Escherichia coli infection (21)
- TGF-beta signaling pathway (21)
- Vascular smooth muscle contraction (21)
- Endometrial cancer (18)
- Acute myeloid leukemia (15)
- Adherens junction (15)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (15)
- Prostate cancer (15)
- Thyroid cancer (15)