Rabbit Polyclonal Anti-WNT5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the C terminal of human WNT5B. Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT |
Rabbit Polyclonal Anti-FZD8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD8 antibody: synthetic peptide directed towards the N terminal of human FZD8. Synthetic peptide located within the following region: PDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHR |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Rabbit Polyclonal Anti-NULP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NULP1 antibody is: synthetic peptide directed towards the N-terminal region of Human NULP1. Synthetic peptide located within the following region: DLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNNRFELINIDDLEDDPVV |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
ROCK2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ROCK2 |
Rabbit Polyclonal JNK1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
USD 465.00
2 Weeks
JNK2 (MAPK9) (incl. pos. control) mouse monoclonal antibody, clone 12C5, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Conjugation | Biotin |
USD 415.00
2 Weeks
JNK2 (MAPK9) (incl. pos. control) mouse monoclonal antibody, clone 12C5, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat |
USD 465.00
2 Weeks
JNK1 (MAPK8) (N-term) (incl. pos. control) mouse monoclonal antibody, clone 5D10, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Conjugation | Biotin |
USD 415.00
2 Weeks
JNK1 (MAPK8) (N-term) (incl. pos. control) mouse monoclonal antibody, clone 5D10, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat |
WNT5A mouse monoclonal antibody, clone 3D10, Ascites
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Mapk8ip2 (226-421) mouse monoclonal antibody, clone S135-37, Purified
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
JNK1 (MAPK8) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide mapping to the C-terminus of human JNK-1 |
WNT3A rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
FZD5/FZD8 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 42-90 of Human Frizzled-5. |
FZD3 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse |
Frizzled 2 (FZD2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 208-260 of Human Frizzled-2. |
MEK4 (MAP2K4) pSer80 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of serine 80 (T-H-Sp-I-E). |
MEK4 (MAP2K4) pSer80 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of serine 80 (T-H-Sp-I-E). |
JNK1/2/3 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200 of Human JNK1. |
Apc10 (ANAPC10) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide |
JNK2 (MAPK9) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to C-terminal residues of Human MAPK9/JNK2. |
JNK2 (MAPK9) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to N-terminal residues of Human MAPK9/JNK2. |
MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
JLP (SPAG9) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from N-terminal domain of JIP-4 protein |
Transcription factor 25 (TCF25) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from N-term domain of TCF25 protein |
CCK4 (PTK7) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Human, Mouse |
| Immunogen | Synthetic peptide derived from Human N-terminal region of CCK-4 |
Germany
Japan
United Kingdom
China
