Germany
Japan
United Kingdom
China
Research Areas
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
USD 428.00
In Stock
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
LRP5 + LRP6 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide surrounding amino acid 437 of Human LRP. |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
WNT3A rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
CD41 (ITGA2B) (alpha) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide derived from N-terminal domain of CD41 |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Filter by
Target Symbol
- MAPK8 (30)
- ESR1 (25)
- KIT (17)
- ROCK2 (17)
- IL6 (15)
- TNF (15)
- RORA (13)
- CEBPB (12)
- PECAM1 (12)
- WNT1 (12)
- CD19 (11)
- CD274 (11)
- IL6ST (11)
- TLR2 (11)
- TLR4 (11)
- CASP1 (10)
- CD8A (10)
- CEBPD (10)
- IL2RA (10)
- WNT2B (10)
- ANAPC5 (9)
- FZD4 (9)
- IL1RN (9)
- ITGB3 (9)
- LEF1 (9)
- MME (9)
- ROCK1 (9)
- WNT5B (9)
- CD4 (8)
- IL3RA (8)
- LRP6 (8)
- TCF25 (8)
- TLR3 (8)
- WNT10A (8)
- CD14 (7)
- CD34 (7)
- CD3E (7)
- DVL2 (7)
- ESR2 (7)
- FZD1 (7)
- FZD9 (7)
- IL1B (7)
- TCF4 (7)
- TCF7L2 (7)
- WNT16 (7)
- WNT2 (7)
- WNT3A (7)
- WNT6 (7)
- ANAPC10 (6)
- FZD10 (6)
- FZD2 (6)
- FZD8 (6)
- ITGA2B (6)
- ITGAX (6)
- LRP5 (6)
- NCAM1 (6)
- PTPRC (6)
- TLR5 (6)
- TLR6 (6)
- TLR8 (6)
- TNFRSF8 (6)
- WNT4 (6)
- WNT9A (6)
- DVL3 (5)
- FZD3 (5)
- FZD5 (5)
- FZD6 (5)
- HLA-DMB (5)
- HLA-DPB1 (5)
- IL10 (5)
- IL12B (5)
- IL18 (5)
- IL18R1 (5)
- IL1R1 (5)
- IL2 (5)
- IL36RN (5)
- LGALS3 (5)
- MAPK9 (5)
- MS4A1 (5)
- PTK7 (5)
- ROR1 (5)
- TSLP (5)
- WNT11 (5)
- WNT5A (5)
- ANAPC13 (4)
- CD33 (4)
- CD5 (4)
- CD68 (4)
- CD74 (4)
- CR2 (4)
- ENTPD6 (4)
- FUT4 (4)
- HLA-A (4)
- HLA-DQB1 (4)
- HLA-DRB1 (4)
- IL4 (4)
- IL6R (4)
- MAPK10 (4)
- ROR2 (4)
- TCF21 (4)
Reactivities
- Human (837)
- Mouse (465)
- Rat (326)
- Bovine (26)
- Monkey (23)
- Chicken (13)
- Dog (12)
- Rabbit (12)
- Hamster (11)
- Gorilla (9)
- Bat (8)
- Horse (8)
- Gibbon (7)
- Pig (7)
- Canis (5)
- Chimpanzee (3)
- Primate (3)
- Xenopus (3)
- Guinea Pig (2)
- C. elegans (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Porcine (1)
- Rhesus Monkey (1)
- Sheep (1)
- Tobacco hornworm (1)
Applications
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (86)
- Phospho-specific (30)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (11)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (7)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Phospho S1490 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T235 (1)
- Phospho Y719 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (482)
- Transmembrane (308)
- Secreted Protein (150)
- ES Cell Differentiation/IPS (147)
- Transcription Factors (78)
- Protein Kinase (76)
- Adult stem cells (61)
- GPCR (40)
- Nuclear Hormone Receptor (38)
- Cancer stem cells (32)
- Stem cell relevant signaling - Wnt Signaling pathway (32)
- Protease (21)
- Embryonic stem cells (19)
- Stem cell - Pluripotency (16)
- Induced pluripotent stem cells (9)
- Phosphatase (4)
Pathways
- Wnt signaling pathway (198)
- Pathways in cancer (189)
- Melanogenesis (150)
- Basal cell carcinoma (139)
- Hematopoietic cell lineage (96)
- Colorectal cancer (95)
- Toll-like receptor signaling pathway (93)
- Cytokine-cytokine receptor interaction (77)
- Hedgehog signaling pathway (73)
- Focal adhesion (56)
- MAPK signaling pathway (54)
- NOD-like receptor signaling pathway (51)
- Cell adhesion molecules (CAMs) (43)
- Progesterone-mediated oocyte maturation (42)
- Fc epsilon RI signaling pathway (40)
- Regulation of actin cytoskeleton (40)
- RIG-I-like receptor signaling pathway (37)
- T cell receptor signaling pathway (37)
- Adipocytokine signaling pathway (36)
- Pathogenic Escherichia coli infection (34)
- Epithelial cell signaling in Helicobacter pylori infection (33)
- Jak-STAT signaling pathway (33)
- Type II diabetes mellitus (33)
- Neurotrophin signaling pathway (32)
- ErbB signaling pathway (31)
- GnRH signaling pathway (31)
- Leukocyte transendothelial migration (29)
- Pancreatic cancer (28)
- Insulin signaling pathway (27)
- TGF-beta signaling pathway (26)
- Chemokine signaling pathway (24)
- Graft-versus-host disease (24)
- Allograft rejection (23)
- Acute myeloid leukemia (22)
- Axon guidance (22)
- Endocytosis (22)
- Primary immunodeficiency (21)
- Type I diabetes mellitus (21)
- Vascular smooth muscle contraction (20)
- Antigen processing and presentation (19)
- Apoptosis (19)
- Asthma (18)
- Alzheimer's disease (17)
- Amyotrophic lateral sclerosis (ALS) (17)
- Cytosolic DNA-sensing pathway (17)
- Hypertrophic cardiomyopathy (HCM) (17)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (16)
- Autoimmune thyroid disease (16)
- Systemic lupus erythematosus (16)
- Cell cycle (15)
- Oocyte meiosis (15)
- Ubiquitin mediated proteolysis (15)
- B cell receptor signaling pathway (14)
- Dilated cardiomyopathy (13)
- Endometrial cancer (12)
- Renin-angiotensin system (12)
- Natural killer cell mediated cytotoxicity (11)
- Adherens junction (10)
- Prion diseases (10)
- Viral myocarditis (10)
- Prostate cancer (9)
- Thyroid cancer (9)
- Notch signaling pathway (8)
- ECM-receptor interaction (7)
- Complement and coagulation cascades (6)
- Fc gamma R-mediated phagocytosis (6)
- Metabolic pathways (4)
- Glutathione metabolism (3)
- PPAR signaling pathway (3)
- Bladder cancer (2)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Renal cell carcinoma (2)
- Small cell lung cancer (2)
- VEGF signaling pathway (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Huntington's disease (1)
- Long-term depression (1)
- Lysosome (1)
- Parkinson's disease (1)