CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Primate |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Primate |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit Polyclonal Anti-TCF7L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773 |
Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit polyclonal Integrin beta3 (Ab-785) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Rabbit polyclonal LEF1 Antibody (N-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit Polyclonal TCF7L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of human TCF7L2 (within residues 150-200). [Swiss-Prot# Q9NQB0] |
TCF7L2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 60-90 amino acids from the N-terminal region of human TCF7L2 |
Goat Polyclonal Antibody against LEF1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QHEQRKEQEPKRPH, from the internal region of the protein sequence according to NP_057353.1. |
Rabbit polyclonal Integrin beta3 (Tyr785) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the N terminal of human LEF1. Synthetic peptide located within the following region: VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the middle region of human LEF1. Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG |
Rabbit Polyclonal Anti-TCF7L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the middle region of human TCF7L2. Synthetic peptide located within the following region: GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES |
Carrier-free (BSA/glycerol-free) LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ITGA2B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGA2B |
Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LEF1 mouse monoclonal antibody,clone OTI10A7, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LEF1 mouse monoclonal antibody,clone OTI10A7, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |