Research Areas

View as table Download

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific

Rabbit polyclonal anti-APC10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10.

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3

Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region

Applications WB
Reactivities Rat, Tobacco hornworm
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

JNK1 (MAPK8) mouse monoclonal antibody, clone 4H6, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

JNK1 (MAPK8) mouse monoclonal antibody, clone 4H5, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

Anti-MAPK10 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10

Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Rabbit Polyclonal JNK1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

JNK1 (MAPK8) mouse monoclonal antibody, clone 1A2, Purified

Applications ELISA, IHC, WB
Reactivities Human

JNK1 (MAPK8) mouse monoclonal antibody, clone 3B12, Purified

Applications ELISA, IHC, WB
Reactivities Human

JNK1 (MAPK8) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 380-420 of Human JNK3.

JNK1 (MAPK8) (+JNK2/3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

JNK1 (MAPK8) pThr183 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Apc5 (ANAPC5) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ANAPC5 antibody was raised against synthetic peptide - KLH conjugated

Rabbit polyclonal anti-MAPK10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAPK10.

Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V).
Modifications Phospho-specific

Rabbit polyclonal anti-ANAPC5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ANAPC5.

Rabbit Polyclonal APC10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC10 antibody was raised against a 16 amino acid synthetic peptide near the center of human APC10.

Rabbit Polyclonal APC5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC5 antibody was raised against a 17 amino acid synthetic peptide near the center of human APC5.

Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185
Modifications Phospho-specific

JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V).

JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V).

JNK1 (MAPK8) (+JNK2/3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

JNK1 (MAPK8) (Thr183/Tyr185) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 159-195 amino acids from human MAPK8 / JNK1

Rabbit Polyclonal antibody to JNK1 (mitogen-activated protein kinase 8)

Applications IF, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 300 of JNK1 (Uniprot ID#P45983)

Rabbit Polyclonal APC11 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC11 antibody was raised against an 18 amino acid synthetic peptide near the center of human APC11.

Anti-MAPK8/MAPK9/MAPK10 (phospho-Thr183/Tyr185) Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of Thr183/Tyr185 (M-M-T(p)-P-Y(p)- V - V ) derived from Human JNK1/JNK2/JNK3.
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK

Goat Anti-ANAPC11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PALDQETSSLLRCTS, from the Internal region of the protein sequence according to NP_001002244.1; NP_057560.8.

JNK2 (MAPK9) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Apc5 (ANAPC5) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 156-185 amino acids from the Central region of human ANAPC5

Rabbit Polyclonal Anti-ANAPC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10. Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL

Rabbit Polyclonal JNK1 Antibody

Applications WB
Reactivities C. elegans (Does not react with: Human, Mammalian, Mouse, Rat)
Conjugation Unconjugated
Immunogen A recombinant protein made to the C-terminus (residues 228-451) of the C. elegans JNK1 alpha protein.

Mouse Monoclonal JNK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse monoclonal Anti-APC11 Clone AX2.1

Reactivities Frog, Human
Conjugation Unconjugated

Mouse monoclonal Anti-APC5 Clone APC5#4

Applications IF
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) anti-JNK1 (MAPK8) mouse monoclonal antibody, clone OTI3B4H9 (formerly 3B4H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ANAPC2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ANAPC2 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated