Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
LRP5 + LRP6 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide surrounding amino acid 437 of Human LRP. |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
WNT3A rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
CD41 (ITGA2B) (alpha) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide derived from N-terminal domain of CD41 |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
NCAM1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NCAM1 |
Germany
Japan
United Kingdom
China
