USD 428.00
In Stock
Rabbit monoclonal anti-ER Antibody, clone OTIR3C2
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-ER Antibody, clone OTIR3C2
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-RORA antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human RORA. |
Rabbit polyclonal Estrogen Receptor-a (Ser102) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of serine 102 (L-N-SP-V-S). |
Modifications | Phospho-specific |
Rabbit Polyclonal ESR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ESR1 antibody was raised against an 18 amino acid peptide near the center of human ESR1. |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Tyr537) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Tyrosine 537 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser104) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 104 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser106) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 106 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser118) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 118 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- beta (Ser105) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- beta around the phosphorylation site of Serine 105 |
Rabbit Polyclonal Anti-RORA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP |
Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser118) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human and Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 118 (Q-L-SP-P-F). |
Modifications | Phospho-specific |
Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser167) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 167 (L-A-SP-T-N). |
Modifications | Phospho-specific |
Rabbit polyclonal RORA Antibody (T216)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This RORA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from human RORA. |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser167) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human:S167 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 167 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RORA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA |
Rabbit anti Estrogen Receptor alpha (ER-alpha) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of human estrogen receptor protein. This sequence is identical to human, Gorilla, Bovine, etc. |
Rabbit anti Estrogen Receptor beta (ER beta) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the c-terminus of human Estrogen Receptor Beta. . |
Rabbit anti ER(pS118) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti ER(pS167) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding the epitope –LASTN- with a phosphorylation site of Ser167 of human estrogen receptor. |
Rabbit anti ER (Paired S167) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding the epitope –LASTN- without phosphorylation of human estrogen receptor. |
Rabbit anti ER(pS305) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding the epitope –KNSLA- with a phosphorylation site of Ser305 of human estrogen receptor. |
Rabbit Polyclonal Anti-RORA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY |
Rabbit Polyclonal Anti-RORA Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK |
Rabbit Polyclonal Anti-RORA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY |
Rabbit Polyclonal Anti-RORA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC |
Rabbit Polyclonal Anti-RORA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI |
Anti-ESR1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 247-261 amino acids of Human estrogen receptor 1 |
Rabbit Polyclonal Anti-ESR2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ESR2 |
Rabbit Polyclonal Anti-RORA rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RORA |
USD 180.00
In Stock
Rabbit monoclonal anti-ER Antibody, clone OTIR3C2
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |