Rabbit polyclonal DVL3 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit polyclonal FZD1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FZD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the Central region of human FZD1. |
Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
| Modifications | Phospho-specific |
Rabbit Polyclonal KIT Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human KIT. |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit Polyclonal Anti-GNAO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal WNT2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT5B Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Dishevelled 3 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
WNT9A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human WNT9A |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Immunogen | WNT7A antibody was raised against synthetic 10 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Chicken, Platypus, Xenopus (80%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Anti-FZD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 188-200 amino acids of human frizzled family receptor 2 |
Anti-WNT9A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A |
Anti-FZD1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of human frizzled family receptor 1 |
Rabbit polyclonal LEF1 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit polyclonal WNT16 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WNT16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-265 amino acids from the C-terminal region of human WNT16. |
Rabbit Polyclonal c-Kit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Goat Polyclonal Antibody against LEF1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QHEQRKEQEPKRPH, from the internal region of the protein sequence according to NP_057353.1. |
Rabbit polyclonal anti-FZD4 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD4. |
Rabbit polyclonal anti-DVL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
WNT2B Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Immunogen | WNT2B antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Platypus (100%); Opossum, Chicken (86%). |
WNT6 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%). |
WNT6 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Mouse, Rabbit, Rat |
| Immunogen | WNT6 antibody was raised against synthetic 20 amino acid peptide from N-terminus of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit (100%); Marmoset, Bat, Opossum, Platypus (95%). |
WNT14 / WNT9A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | WNT14 / WNT9A antibody was raised against synthetic 17 amino acid peptide from internal region of human WNT9A. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Bat (94%); Mouse, Rat, Hamster, Bovine, Rabbit (88%); Elephant, Dog, Horse (82%). |
WNT14 / WNT9A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | WNT14 / WNT9A antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human WNT9A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Mouse, Rat, Bovine, Bat, Rabbit (94%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Dog, Bovine (100%); Mouse, Rat, Hamster, Bat, Rabbit (94%); Opossum (81%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | WNT10A antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Rabbit (100%); Elephant, Bat (94%); Chicken (89%); Opossum, Turkey, Lizard, Xenopus, Stickleback, Pufferfish (83%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Rabbit (100%); Rat, Hamster, Opossum (94%). |
WNT11 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%). |
WNT4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | WNT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (100%); Opossum (86%). |
WNT4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | WNT4 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant (94%); Opossum (88%). |
Rabbit polyclonal anti-Dvl3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 583 of mouse Dvl3 |
Rabbit polyclonal anti-Wnt-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human Wnt-1 |
Rabbit polyclonal anti-Wnt1 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein. |
Goat Polyclonal KIT/CD117 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KRDSFICSKQEDH, from the internal region of the protein sequence according to NP_000213.1; NP_001087241.1 |
Anti-Human WNT-1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human WNT-1 |
Anti-Human WNT-3a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived recombinant Human WNT-3a. |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ |
Rabbit Polyclonal Anti-WNT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR |
Rabbit Polyclonal Anti-WNT4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT4 antibody: synthetic peptide directed towards the middle region of human WNT4. Synthetic peptide located within the following region: HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the N terminal of human LEF1. Synthetic peptide located within the following region: VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the middle region of human LEF1. Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG |
Germany
Japan
United Kingdom
China
