Research Areas

View as table Download

Phospho-RAC1-S71 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S71 of human RAC1

Rabbit Polyclonal ROCK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK1

Rabbit Polyclonal ROCK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2.

Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1

Rabbit Polyclonal ROCK2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK2

Rabbit polyclonal ROCK2 (Ab-722) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human ROCK2 around the phosphorylation site of tyrosine 722 (K-I-YP-E-S).

ROCK2 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ROCK2 antibody was raised against synthetic peptide

ROCK2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human ROCK2

Rabbit Polyclonal ROCK1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human ROCK1.

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

Rabbit polyclonal Rock-2 phospho Y256 antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y256 of human ROCK-2.
Modifications Phospho-specific

Mouse Monoclonal cleaved ROCK1 Antibody (154C1465)

Applications WB
Reactivities Human, Mouse, Rat, Canine, Primate, Rabbit
Conjugation Unconjugated

Rabbit anti Rho Kinase/ROCKII (pT396) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -VETFP- with a single phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (Paired T396) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -VETFP- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (IN) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide (19mer) derived from 250-350 amino acids of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (pT249) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -CDTAV- with a single phosphorylation site Thr249 of human Rho Kinase/RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (Paired T249) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -CDTAV- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Anti-ROCK1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1115-1354 amino acids of human Rho-associated, coiled-coil containing protein kinase 1

Anti-ROCK1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1115-1354 amino acids of human Rho-associated, coiled-coil containing protein kinase 1

Anti-ROCK2 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human Rho-associated, coiled-coil containing protein kinase 2

Anti-ROCK2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human Rho-associated, coiled-coil containing protein kinase 2