Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal PD-L1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal HLA-G Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Goat Polyclonal Anti-CD45 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
CD274 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD274 |
Rabbit Polyclonal CD4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Modifications | Phospho-specific |
Goat Polyclonal Antibody against PD-L1 / CD274
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CKKQSDTHLEET, from the C Terminus of the protein sequence according to NP_054862.1. |
Mouse PD-1 / CD279 Monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-1 Antibody [4C7]
Applications | ELISA, FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal PD-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | PD-1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human PD-1. |
Mouse Monoclonal Anti-PD-1 Antibody [7H6]
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rat Anti-Human/Mouse CD45R (B220) Purified (100 ug)
Applications | FC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NCAM1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NCAM1 |
Mouse Monoclonal Anti-PD-1 Antibody [4D6]
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-1 Antibody [8A4]
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-1 Antibody [10B3]
Applications | ELISA, FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [4F2]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [8E12]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CD45 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit Polyclonal Antibody against CD8A (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit Polyclonal PD-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PD-1 antibody was raised against a 16 amino acid peptide from near the center of human PD-1. |
Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068) |
Rabbit Polyclonal CD31/PECAM1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Pecam1 protein (within residues 100-300). [Swiss-Prot P16284] |
Mouse Anti-Human CD45RA Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal HLA-B Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit Polyclonal PECAM-1 (Tyr713) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PECAM-1 around the phosphorylation site of Tyrosine 713 |
Modifications | Phospho-specific |
Rabbit Polyclonal CD45 (Ser1007) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD45 around the phosphorylation site of Serine 1007 |
Modifications | Phospho-specific |
Rabbit polyclonal Anti-HLA-F Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Mouse Monoclonal Anti-PD-L1 Antibody [6H10]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [2D6]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [1F11]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [1D7]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-GAD1/2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GAD1/GAD2. |
Mouse PD-1 Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-PTPRC Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PTPRC |
Mouse Monoclonal CD8 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CD31 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to C-terminus of mouse CD31 protein. |
Rabbit anti CD8 Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CD45/LCA Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein encoding aa 1119-1304 of human CD45. |
Rabbit anti CD34 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-CD45 Antibody Summary
Reactivities | Cross-reacts with Human |
Conjugation | Unconjugated |
CD19 Capture mouse monoclonal antibody, Luminex validated, clone OTI1E9
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700285 |