Products

View as table Download

Rabbit polyclonal Parkin Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 387-417 amino acids from the C-terminal region of human Parkin.

PARK2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PARK2

Rabbit polyclonal Parkin Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 111-140 amino acids from the N-terminal region of human Parkin.

Rabbit polyclonal Parkin antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Parkin antibody.

Rabbit Polyclonal Anti-Parkin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Parkin Antibody: A synthesized peptide derived from human Parkin

Rabbit Polyclonal Anti-PDCL Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PDCL antibody was raised against a 16 amino acid peptide near the amino terminus of human PDCL.

Rabbit Anti-Parkin (Ser101) Antibody (Phospho-Specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser101 conjugated to KLH
Modifications Phospho-specific

Rabbit Anti-Parkin (Ser378) Antibody (Phospho-Specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser378 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal anti-Park2 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Park2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG

PRKN Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PARK2

PRKN Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PARK2

Parkin Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human Parkin
Modifications Unmodified

Parkin (phospho-S131) polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human Parkin around the phosphorylation site of S131.