Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Products
USD 180.00
In Stock
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
VIP rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Porcine VIP coupled to bovine thyroglobulin (BTg) with carbodiimide (CDI) linker. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Active filters
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Filter by
Target Symbol
- EGFR (85)
- MAPT (79)
- AKT1 (67)
- H3C1 (65)
- TP53 (62)
- S PROTEIN (61)
- RELA (54)
- CAPSID (48)
- NPPB (45)
- JUN (41)
- N PROTEIN (40)
- BCL2 (39)
- POMC (38)
- AMH (37)
- APP (37)
- ERBB2 (36)
- IRS1 (36)
- MAP2K1 (35)
- STAT3 (35)
- MAPK14 (34)
- CASP3 (33)
- NFKBIA (33)
- CREB1 (32)
- ESR1 (32)
- SMAD3 (32)
- GSK3B (31)
- CTNNB1 (30)
- RB1 (30)
- SMAD2 (30)
- ATF2 (29)
- HIF1A (29)
- HSPB1 (29)
- YAP1 (29)
- FOXO1 (28)
- GCG (28)
- JAK2 (28)
- KDR (28)
- STAT1 (28)
- CHUK (27)
- MAPK1 (27)
- MYC (27)
- PRKAA1 (27)
- RAF1 (27)
- RPS6KB1 (27)
- UBB (27)
- BRAF (26)
- BRCA1 (26)
- CDKN2A (26)
- CHEK1 (26)
- EZR (26)
- H3-4 (26)
- IGF1R (26)
- NFKB1 (26)
- NPPA (26)
- SMAD1 (26)
- BAX (25)
- CD44 (25)
- EIF4EBP1 (25)
- NR3C1 (25)
- PRKCD (25)
- PTEN (25)
- PTK2 (25)
- BAD (24)
- CDC25A (24)
- CDK1 (24)
- EDN1 (24)
- HISTONE H3 (24)
- MAPK8 (24)
- PRKCA (24)
- CASP9 (23)
- CCNB1 (23)
- MAP3K5 (23)
- VEGFA (23)
- VIM (23)
- CALCA (22)
- CDH1 (22)
- CSF1R (22)
- HIST1H3A (22)
- PIK3R1 (22)
- RPS6KA1 (22)
- SNCA (22)
- STAT6 (22)
- CHEK2 (21)
- GSK3A (21)
- HDAC2 (21)
- IKBKG (21)
- MET (21)
- NOS3 (21)
- PDYN (21)
- PENK (21)
- RUNX1 (21)
- TGFB1 (21)
- AR (20)
- ELK1 (20)
- GAPDH (20)
- GRIA2 (20)
- GRIN1 (20)
- IL4 (20)
- MAP3K7 (20)
- MTOR (20)
Reactivities
- Human (61363)
- Mouse (33647)
- Rat (23922)
- Bovine (997)
- Monkey (520)
- Chicken (351)
- Pig (350)
- Dog (294)
- Rabbit (264)
- Hamster (232)
- Xenopus (223)
- Rhesus Monkey (168)
- Gorilla (157)
- Primate (155)
- Zebrafish (148)
- Mammalian (144)
- Horse (141)
- Chimpanzee (136)
- Porcine (131)
- Gibbon (122)
- SARS-CoV-2 (122)
- Bat (108)
- X. tropicalis (101)
- Murine (78)
- Canine (76)
- Guinea Pig (60)
- Sheep (59)
- Cow (50)
- HIV (48)
- Drosophila (45)
- Orang-Utan (38)
- Other (Wide Range) (34)
- Feline (33)
- Broad (26)
- Macaque (20)
- C. elegans (19)
- Equine (18)
- Canis (12)
- Goat (12)
- C-term DDK (10)
- Fish (9)
- Vertebrates (9)
- Avian (8)
- Yeast (8)
- Gerbil (7)
- SARS-CoV (7)
- Adenovirus 8 (6)
- Opossum (6)
- All Species (5)
- Adenovirus 5 (4)
- Escherichia coli (4)
- Quail (4)
- Arabidopsis (3)
- Baboon (3)
- EV-71 (3)
- Frog (3)
- Fusion proteins containing the Flag Tag (3)
- HCoV-HKU1 (3)
- HCoV-OC43 (3)
- Invertebrate (3)
- Saccharomyces cerevisiae (3)
- Turkey (3)
- Adenovirus (2)
- Adenovirus 9 (2)
- Coral (2)
- Cynomolgus (2)
- Ferret (2)
- Fungus (2)
- HCoV-229E (2)
- N-term and C-term DDK (2)
- Pufferfish (2)
- Streptococcus Pyogenes (2)
- 5-FAM (1)
- Algal (1)
- Amphibian (1)
- Beluga (1)
- Biotin (1)
- Birds (1)
- Carp (1)
- Dengue virus (1)
- Digoxin (1)
- Dogfish (1)
- Drosophila melanogaster (1)
- Eukaryote (1)
- FITC (1)
- HCoV-NL63 (1)
- Hagfish (1)
- Horseradish Peroxidase (1)
- Insect (1)
- Marmoset (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Protozoa (1)
- Respiratory Syncytial Virus (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Tadpole (1)
- Tobacco (1)
- Tobacco hornworm (1)
- Tomato (1)
- Tree Shrew (1)
- Virus (1)
- West Nile Virus (1)
- Whale (1)
- Yellow Fever Virus (1)
Applications
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
- Unmodified (9273)
- Phospho-specific (1459)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (94)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (36)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (27)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (23)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (20)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (18)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. (17)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (8)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (7)
- Phospho S83 (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (6)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (6)
- Acetyl K5 (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original VHH format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (4)
- This is a chimeric antibody created as part of a panel offering antibodies of the same specificity in different formats (species, isotype, subtype and modified versions) for use as isotype controls. (4)
- Phospho S15 (3)
- Phospho S166 (3)
- Phospho S376 (3)
- Phospho T286 (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG2 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgM format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- Acetyl K4 (2)
- MonoMethyl K342 (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S128 (2)
- Phospho S129 (2)
- Phospho S139 (2)
- Phospho S16 (2)
- Phospho S176/180 (2)
- Phospho S21 (2)
- Phospho S319 (2)
- Phospho S345 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S396 (2)
- Phospho S56 (2)
- Phospho S616 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- Phospho S89 (2)
- Phospho S9 (2)
- Phospho T183/T172 (2)
- Phospho T187 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- Phospho Y410 (2)
- Phospho Y779 (2)
- Phospho Y925 (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K262/K265/K274 (1)
- Acetyl K29 (1)
- Acetyl K332 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- K11-linkage Specific Polyubiquitin (1)
- K27-linkage Specific Polyubiquitin (1)
- K29-linkage Specific Polyubiquitin (1)
- K33-linkage Specific Polyubiquitin (1)
- K48-linkage Specific Polyubiquitin (1)
- K6-linkage Specific Polyubiquitin (1)
- K63-linkage Specific Polyubiquitin (1)
- M1-linkage Specific Polyubiquitin (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho 180/Y182,Phospho T180/Y182,Phospho T180/Y182,Phospho T183/Y1845 (1)
- Phospho Phospho S87 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S102 (1)
- Phospho S1033 (1)
- Phospho S11 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S1387 (1)
- Phospho S1490 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S194 (1)
- Phospho S1943 (1)
- Phospho S1981 (1)
- Phospho S199/S204 (1)
- Phospho S2 (1)
- Phospho S20 (1)
- Phospho S202 (1)
- Phospho S2056 (1)
- Phospho S209 (1)
- Phospho S211 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S22 (1)
- Phospho S235/236 (1)
- Phospho S240/244 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S2481 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S259 (1)
- Phospho S271 (1)
- Phospho S271/T275 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S291 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S296 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S304 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S32 (1)
- Phospho S32/S36 (1)
- Phospho S320 (1)
- Phospho S323 (1)
- Phospho S326 (1)
- Phospho S33 (1)
- Phospho S33/35 (1)
- Phospho S33/S37/T41 (1)
- Phospho S330 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S358 (1)
- Phospho S36 (1)
- Phospho S365 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S40 (1)
- Phospho S409/S410 (1)
- Phospho S412 (1)
- Phospho S420 (1)
- Phospho S422 (1)
- Phospho S423/S425 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S445 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S465/S467 (1)
- Phospho S467 (1)
- Phospho S471/472 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S483 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S507 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S519/T522 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S555 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S6 (1)
- Phospho S608 (1)
- Phospho S611/615 (1)
- Phospho S611/615/616 (1)
- Phospho S612 (1)
- Phospho S615 (1)
- Phospho S62 (1)
- Phospho S621 (1)
- Phospho S63 (1)
- Phospho S636/639 (1)
- Phospho S637 (1)
- Phospho S638 (1)
- Phospho S641 (1)
- Phospho S643/676 (1)
- Phospho S645 (1)
- Phospho S65 (1)
- Phospho S657/Y658 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S675 (1)
- Phospho S7 (1)
- Phospho S70 (1)
- Phospho S71 (1)
- Phospho S728 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S757 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S811 (1)
- Phospho S82 (1)
- Phospho S838/S840 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S890 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S916 (1)
- Phospho S932 (1)
- Phospho S957 (1)
- Phospho S967 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser551 (1)
- Phospho Ser729 (1)
- Phospho Ser792 (1)
- Phospho Ser90 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T1462 (1)
- Phospho T156 (1)
- Phospho T163 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T180/Y182 + T183/Y1845 (1)
- Phospho T181 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T184/T187 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T199 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T202/Y204+T185/Y187 (1)
- Phospho T204 (1)
- Phospho T210 (1)
- Phospho T212 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T231 (1)
- Phospho T231/S232 (1)
- Phospho T232 (1)
- Phospho T235 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T246 (1)
- Phospho T261 (1)
- Phospho T288 (1)
- Phospho T288,Phospho T232,Phospho T198 (1)
- Phospho T292 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T346 (1)
- Phospho T357/S358/S360 (1)
- Phospho T359 (1)
- Phospho T359/S363 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T434 (1)
- Phospho T446 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T505 (1)
- Phospho T508/T505 (1)
- Phospho T538 (1)
- Phospho T543 (1)
- Phospho T56 (1)
- Phospho T567,Phospho T564,Phospho T558 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T642 (1)
- Phospho T668 (1)
- Phospho T669 (1)
- Phospho T678 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T696 (1)
- Phospho T70 (1)
- Phospho T81 (1)
- Phospho T845 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T93 (1)
- Phospho T982 (1)
- Phospho Thr212/Ser214 (1)
- Phospho Thr421 (1)
- Phospho Y10 (1)
- Phospho Y1007 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1008 (1)
- Phospho Y1018 (1)
- Phospho Y1020 (1)
- Phospho Y1021 (1)
- Phospho Y1022/1023 (1)
- Phospho Y1045 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1068 (1)
- Phospho Y1070 (1)
- Phospho Y1086 (1)
- Phospho Y1096 (1)
- Phospho Y1148 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1173 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1217 (1)
- Phospho Y1221/1222 (1)
- Phospho Y1234/1235 (1)
- Phospho Y1248 (1)
- Phospho Y1284 (1)
- Phospho Y133 (1)
- Phospho Y1349 (1)
- Phospho Y1361 (1)
- Phospho Y138 (1)
- Phospho Y139 (1)
- Phospho Y14 (1)
- Phospho Y145 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y171 (1)
- Phospho Y177 (1)
- Phospho Y182 (1)
- Phospho Y191 (1)
- Phospho Y204 (1)
- Phospho Y207 (1)
- Phospho Y216 (1)
- Phospho Y221 (1)
- Phospho Y232 (1)
- Phospho Y245 (1)
- Phospho Y284 (1)
- Phospho Y291 (1)
- Phospho Y292 (1)
- Phospho Y307 (1)
- Phospho Y311 (1)
- Phospho Y317 (1)
- Phospho Y322 (1)
- Phospho Y323 (1)
- Phospho Y340 (1)
- Phospho Y353 (1)
- Phospho Y397 (1)
- Phospho Y402 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y416/Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y564 (1)
- Phospho Y576/577 (1)
- Phospho Y589/591 (1)
- Phospho Y594 (1)
- Phospho Y653 (1)
- Phospho Y659 (1)
- Phospho Y674/675 + Y706/707 (1)
- Phospho Y694 (1)
- Phospho Y699 (1)
- Phospho Y700 (1)
- Phospho Y705 (1)
- Phospho Y708 (1)
- Phospho Y719 (1)
- Phospho Y723 (1)
- Phospho Y724 (1)
- Phospho Y731 (1)
- Phospho Y751 (1)
- Phospho Y754 (1)
- Phospho Y759 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y845 (1)
- Phospho Y849 (1)
- Phospho Y869 (1)
- Phospho Y980/981 (1)
- Phospho Y992 (1)
- Phospho Y996 (1)
- Phospho Y998 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-(Ser/Thr) (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Phospho-RPS6KB1-S371 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Chicken scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- Ubiquityl K119 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
- monoMethyl E105 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- pan-Di-Methyl K (1)
- pan-Mono-Methyl K (1)
- pan-Mono-MethylR（R*GG） (1)
- pan-Myristyl-G (1)
- pan-Phospho-Serine (1)
- pan-TriMethyl-lysine (1)
- pan-tri-Methyl K (1)
- phospho S76 (1)
- phospho T1079,Phospho T1041 (1)
- succinylation K79 (1)
Assay Types
Assay Platforms
Families
- Druggable Genome (19336)
- Transmembrane (8892)
- Transcription Factors (5766)
- Secreted Protein (2951)
- Protein Kinase (2220)
- ES Cell Differentiation/IPS (1851)
- Stem cell - Pluripotency (1278)
- GPCR (1086)
- Protease (1074)
- Adult stem cells (415)
- Embryonic stem cells (363)
- Phosphatase (341)
- Nuclear Hormone Receptor (324)
- Cancer stem cells (288)
- Ion Channels: Other (266)
- Stem cell relevant signaling - JAK/STAT signaling pathway (239)
- Induced pluripotent stem cells (223)
- Ion Channels: Potassium (163)
- P450 (150)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (127)
- Stem cell relevant signaling - DSL/Notch pathway (119)
- Ion Channels: Cys-loop Receptors (108)
- Stem cell relevant signaling - Wnt Signaling pathway (103)
- Ion Channels: Transient receptor potential (87)
- Ion Channels: Glutamate Receptors (73)
- Ion Channels: Sodium (34)
- Ion Channels: ATP Receptors (23)
- Ion Channels: Cyclic nucleotide gated (16)
- Ion Channels: Calcium (12)
Pathways
- Metabolic pathways (2316)
- Pathways in cancer (2300)
- MAPK signaling pathway (1494)
- Focal adhesion (1149)
- Cytokine-cytokine receptor interaction (1114)
- Neuroactive ligand-receptor interaction (997)
- Chemokine signaling pathway (973)
- Neurotrophin signaling pathway (959)
- Prostate cancer (925)
- Regulation of actin cytoskeleton (879)
- Cell cycle (781)
- Colorectal cancer (769)
- Chronic myeloid leukemia (762)
- Pancreatic cancer (751)
- Insulin signaling pathway (739)
- Jak-STAT signaling pathway (730)
- T cell receptor signaling pathway (730)
- ErbB signaling pathway (727)
- Wnt signaling pathway (704)
- Calcium signaling pathway (703)
- Apoptosis (689)
- Small cell lung cancer (683)
- Endocytosis (679)
- Toll-like receptor signaling pathway (677)
- Alzheimer's disease (642)
- Leukocyte transendothelial migration (622)
- Acute myeloid leukemia (587)
- Melanoma (584)
- Progesterone-mediated oocyte maturation (577)
- Huntington's disease (566)
- Glioma (558)
- Natural killer cell mediated cytotoxicity (556)
- B cell receptor signaling pathway (553)
- Adipocytokine signaling pathway (541)
- Endometrial cancer (528)
- Non-small cell lung cancer (523)
- Tight junction (512)
- Adherens junction (506)
- Fc gamma R-mediated phagocytosis (499)
- Oocyte meiosis (487)
- p53 signaling pathway (486)
- Renal cell carcinoma (484)
- Axon guidance (483)
- Melanogenesis (481)
- VEGF signaling pathway (478)
- GnRH signaling pathway (477)
- Epithelial cell signaling in Helicobacter pylori infection (461)
- TGF-beta signaling pathway (459)
- Fc epsilon RI signaling pathway (443)
- Ubiquitin mediated proteolysis (442)
- Gap junction (434)
- NOD-like receptor signaling pathway (432)
- Olfactory transduction (430)
- Bladder cancer (416)
- Vascular smooth muscle contraction (409)
- Amyotrophic lateral sclerosis (ALS) (407)
- Cell adhesion molecules (CAMs) (401)
- RIG-I-like receptor signaling pathway (396)
- mTOR signaling pathway (378)
- Hematopoietic cell lineage (354)
- Parkinson's disease (353)
- Long-term potentiation (336)
- Systemic lupus erythematosus (328)
- Purine metabolism (319)
- Long-term depression (315)
- Dilated cardiomyopathy (312)
- Pathogenic Escherichia coli infection (311)
- Hypertrophic cardiomyopathy (HCM) (298)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (289)
- Cytosolic DNA-sensing pathway (276)
- Basal cell carcinoma (271)
- Type II diabetes mellitus (267)
- Spliceosome (257)
- PPAR signaling pathway (250)
- Viral myocarditis (250)
- Antigen processing and presentation (245)
- ECM-receptor interaction (243)
- Thyroid cancer (242)
- Lysosome (234)
- Complement and coagulation cascades (226)
- Glycolysis / Gluconeogenesis (224)
- Prion diseases (198)
- Oxidative phosphorylation (196)
- Hedgehog signaling pathway (192)
- Notch signaling pathway (191)
- Pyrimidine metabolism (185)
- Phosphatidylinositol signaling system (180)
- Vibrio cholerae infection (180)
- Ribosome (176)
- Drug metabolism - cytochrome P450 (173)
- Arginine and proline metabolism (172)
- Metabolism of xenobiotics by cytochrome P450 (171)
- Primary immunodeficiency (168)
- Dorso-ventral axis formation (161)
- Cardiac muscle contraction (153)
- Nucleotide excision repair (153)
- Retinol metabolism (137)
- Type I diabetes mellitus (135)
- Valine (135)
- Arachidonic acid metabolism (133)
- Tyrosine metabolism (131)
- RNA degradation (128)
- Base excision repair (124)
- Proteasome (124)
- Inositol phosphate metabolism (122)
- Fatty acid metabolism (118)
- Pyruvate metabolism (118)
- leucine and isoleucine degradation (117)
- Glycerolipid metabolism (116)
- Regulation of autophagy (116)
- Autoimmune thyroid disease (115)
- Homologous recombination (115)
- ABC transporters (113)
- DNA replication (113)
- Glycerophospholipid metabolism (113)
- Graft-versus-host disease (113)
- Tryptophan metabolism (113)
- Allograft rejection (112)
- Alanine (111)
- aspartate and glutamate metabolism (111)
- Maturity onset diabetes of the young (107)
- Drug metabolism - other enzymes (105)
- Fructose and mannose metabolism (101)
- Glutathione metabolism (100)
- Lysine degradation (100)
- Cysteine and methionine metabolism (98)
- Starch and sucrose metabolism (98)
- Butanoate metabolism (97)
- Amino sugar and nucleotide sugar metabolism (96)
- Basal transcription factors (96)
- Taste transduction (94)
- Citrate cycle (TCA cycle) (86)
- Mismatch repair (86)
- Sphingolipid metabolism (85)
- Androgen and estrogen metabolism (80)
- Asthma (80)
- Porphyrin and chlorophyll metabolism (79)
- Histidine metabolism (76)
- Propanoate metabolism (76)
- Glycine (74)
- serine and threonine metabolism (74)
- Non-homologous end-joining (73)
- Galactose metabolism (72)
- Nitrogen metabolism (70)
- SNARE interactions in vesicular transport (65)
- Pentose phosphate pathway (62)
- Renin-angiotensin system (61)
- Phenylalanine metabolism (60)
- beta-Alanine metabolism (60)
- Aminoacyl-tRNA biosynthesis (59)
- N-Glycan biosynthesis (57)
- Ether lipid metabolism (55)
- Linoleic acid metabolism (54)
- Nicotinate and nicotinamide metabolism (54)
- Biosynthesis of unsaturated fatty acids (46)
- RNA polymerase (46)
- Selenoamino acid metabolism (46)
- Ascorbate and aldarate metabolism (42)
- Pentose and glucuronate interconversions (42)
- Primary bile acid biosynthesis (41)
- Riboflavin metabolism (40)
- Limonene and pinene degradation (39)
- Glycosaminoglycan degradation (38)
- Terpenoid backbone biosynthesis (36)
- Circadian rhythm - mammal (32)
- Folate biosynthesis (32)
- O-Glycan biosynthesis (32)
- C21-Steroid hormone metabolism (31)
- One carbon pool by folate (31)
- Chondroitin sulfate biosynthesis (30)
- Glycosphingolipid biosynthesis - lacto and neolacto series (30)
- Glyoxylate and dicarboxylate metabolism (30)
- Heparan sulfate biosynthesis (30)
- Pantothenate and CoA biosynthesis (28)
- Taurine and hypotaurine metabolism (28)
- Other glycan degradation (27)
- Keratan sulfate biosynthesis (25)
- Glycosphingolipid biosynthesis - ganglio series (23)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (23)
- Steroid biosynthesis (23)
- alpha-Linolenic acid metabolism (23)
- leucine and isoleucine biosynthesis (23)
- Caffeine metabolism (22)
- Synthesis and degradation of ketone bodies (22)
- Fatty acid elongation in mitochondria (18)
- Methane metabolism (18)
- Sulfur metabolism (18)
- Glycosphingolipid biosynthesis - globo series (17)
- Fatty acid biosynthesis (15)
- Phenylalanine (14)
- tyrosine and tryptophan biosynthesis (14)
- Cyanoamino acid metabolism (13)
- Protein export (13)
- Vitamin B6 metabolism (12)
- D-Glutamine and D-glutamate metabolism (11)
- Thiamine metabolism (11)
- Lysine biosynthesis (10)
- Ubiquinone and other terpenoid-quinone biosynthesis (7)
- Lipoic acid metabolism (6)
- O-Mannosyl glycan biosynthesis (4)
- D-Arginine and D-ornithine metabolism (1)