Products

View as table Download

Rabbit anti-ACAT1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACAT1

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1. Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the N terminal of human OXCT1. Synthetic peptide located within the following region: TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the middle region of human OXCT1. Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Rabbit Polyclonal Anti-OXCT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT2 antibody: synthetic peptide directed towards the middle region of human OXCT2. Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV

Rabbit Polyclonal Anti-BDH2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDH2 antibody: synthetic peptide directed towards the middle region of human BDH2. Synthetic peptide located within the following region: NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the C terminal of human HMGCS2. Synthetic peptide located within the following region: DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the N terminal of human HMGCS2. Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE

Rabbit Polyclonal Anti-HMGCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the N terminal of human HMGCL. Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA

Rabbit Polyclonal Anti-HMGCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the C terminal of human HMGCL. Synthetic peptide located within the following region: LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human ACAT1.
Epitope: Internal.

Rabbit Polyclonal antibody to HMGCL (3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 325 of HMGCL (Uniprot ID#P35914)

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide

Rabbit anti-ACAT2 polyclonal antibody

Applications WB
Reactivities Human, Murine, Rat, Porcine, Ovine
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ACAT 2

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

HMGCS1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the Center region of human HMGCS1

HMGCS1 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human HMGCS1

HMGCS2 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human HMGCS2

HMGCL (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 160-190 amino acids from the Central region of human HMG-CoA lyase / HMGCL

Rabbit anti-ACAT1 polyclonal antibody

Applications WB
Reactivities Human, Porcine, Rat, Murine
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ACAT1.

Rabbit Polyclonal Anti-Hmgcl Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL

Rabbit Polyclonal Anti-BDH1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human BDH1

Rabbit Polyclonal Anti-HMGCL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMGCL

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OXCT1

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HMGCS1

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HMGCS2