Products

View as table Download

Rabbit Polyclonal Anti-FBL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBL antibody: synthetic peptide directed towards the N terminal of human FBL. Synthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN

FBL Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Monkey, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FBL

Anti-FBL Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.297~301( L-T-L-E-P) derived from Human Fibrillarin

Fibrillarin/U3 RNP Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-321 of human Fibrillarin/U3 RNP (NP_001427.2).
Modifications Unmodified

Fibrillarin Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Fibrillarin

Fibrillarin Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated