Germany
Japan
United Kingdom
China
Products
Download
Rabbit anti-CD99 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD99 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-PVRL2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVRL2 |
Rabbit Polyclonal Anti-CLDN23 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
Syndecan 1 (SDC1) mouse monoclonal antibody, clone B-A38, Biotin
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Biotin |
CD62L (SELL) mouse monoclonal antibody, clone DREG56, Purified
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
CD34 mouse monoclonal antibody, clone QBEnd-10, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human, Primate |
ICOSL / B7-H2 Mouse Monoclonal (2D3) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal SELL Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SELL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 346-372 amino acids from the C-terminal region of human SELL. |
F11R Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F11R |
SELL Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SELL |
CD2 mouse monoclonal antibody, clone B-E2, Aff - Purified
| Applications | FC, FN, IF, IHC |
| Reactivities | Human |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Myelin Protein Zero (MPZ) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Two antipeptide antibodies were generated in Chickens against sequences shared between the Mouse (NP_032649) and Human (NP_000521) gene products. Production: After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 0.2 mg/ml. Finally, equal volumes of both of these affinity purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Claudin 7 (Ab-210) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V). |
Rabbit polyclonal CDH4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 175-203 amino acids from the N-terminal region of human CDH4. |
Rabbit polyclonal CDH3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CDH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 114-142 amino acids from the N-terminal region of human CDH3. |
Active filters
Applications
- IHC
Pathways
- Cell adhesion molecules (CAMs)
Filter by
Target Symbol
- PECAM1 (107)
- CD4 (85)
- CD99 (82)
- PTPRC (76)
- NCAM1 (57)
- CDH1 (54)
- PDCD1 (54)
- L1CAM (43)
- PDCD1LG2 (41)
- CD40 (40)
- CD8A (37)
- CD2 (36)
- CD34 (34)
- CD80 (31)
- CD22 (27)
- SDC1 (24)
- VCAM1 (23)
- CD274 (19)
- CDH2 (16)
- CDH4 (16)
- ITGAM (16)
- ICOSLG (15)
- SPN (13)
- CTLA4 (12)
- NECTIN1 (12)
- ICAM3 (10)
- CDH5 (9)
- CLDN3 (8)
- ITGA6 (8)
- SMURF2 (8)
- CDH3 (7)
- CLDN1 (7)
- CLDN7 (7)
- F11R (7)
- ICAM1 (7)
- CD276 (6)
- HLA-DRB5 (6)
- ITGB1 (6)
- NEGR1 (5)
- PTPRM (5)
- CD28 (4)
- CLDN2 (4)
- CLDN5 (4)
- CNTNAP2 (4)
- GLG1 (4)
- ITGA4 (4)
- ITGB2 (4)
- MPZ (4)
- NECTIN2 (4)
- ALCAM (3)
- CADM3 (3)
- CLDN10 (3)
- CLDN11 (3)
- CLDN23 (3)
- CLDN4 (3)
- ITGAL (3)
- MADCAM1 (3)
- SELE (3)
- SELL (3)
- SELPLG (3)
- CADM1 (2)
- CD40LG (2)
- CLDN18 (2)
- CLDN19 (2)
- CLDN8 (2)
- CNTN1 (2)
- HLA-DMB (2)
- HLA-DPB1 (2)
- HLA-G (2)
- ITGAV (2)
- JAM2 (2)
- MAG (2)
- PVR (2)
- CD226 (1)
- CD6 (1)
- CD86 (1)
- CDH15 (1)
- CLDN16 (1)
- CLDN17 (1)
- CLDN6 (1)
- CNTNAP1 (1)
- HLA-A (1)
- HLA-B (1)
- HLA-DMA (1)
- HLA-DOA (1)
- HLA-F (1)
- ICAM2 (1)
- ICOS (1)
- ITGA8 (1)
- ITGB7 (1)
- NECTIN3 (1)
- NFASC (1)
- NLGN1 (1)
- NRCAM (1)
- SDC4 (1)
- VCAN (1)