Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-ACAA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
Rabbit Polyclonal Anti-FADS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FADS1 antibody: synthetic peptide directed towards the C terminal of human FADS1. Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL |
Rabbit polyclonal YOD1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This YOD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-347 amino acids from the C-terminal region of human YOD1. |
Rabbit Polyclonal Anti-SCD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
SCD1 (SCD) mouse monoclonal antibody, clone CD.E10, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse |
SCD1 (SCD) (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
| Immunogen | Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3. |
Rabbit polyclonal HADHA Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA. |
Rabbit polyclonal anti-ELOVL2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELOVL2. |
Rabbit Polyclonal Anti-ELOVL5 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Panda (93%); Goat, Dog, Bat, Bovine, Rabbit, Opossum (87%); Elephant, Horse, Turkey, Chicken, Lizard (80%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Turkey, Chicken (100%); Elephant, Catfish (93%); Mouse, Rat, Dog, Hamster, Horse, Rabbit, Opossum, Platypus (87%); Bovine, Goat, Panda, Xenopus, Salmon (80%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 17 amino acid peptide from internal region of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset (100%); Gibbon, Mouse, Hamster, Elephant, Rabbit (94%); Rat, Dog, Panda (88%); Bat, Bovine, Goat (82%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 18 amino acid peptide from internal region of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Elephant, Rabbit (100%); Marmoset, Mouse, Dog (94%); Rat, Hamster, Panda (89%); Bat (83%). |
Anti-ACOT1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA thioesterase 1 |
Anti-ACOT2 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2 |
Anti-ACOX3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl |
Anti-ACOX1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 1, palmitoyl |
Rabbit Polyclonal Anti-BAAT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BAAT |
Rabbit Polyclonal Anti-FADS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FADS1 |
Rabbit Polyclonal Anti-ELOVL6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ELOVL6 |
Rabbit Polyclonal Anti-SCD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SCD |
Active filters
Applications
- IHC
Pathways
- Biosynthesis of unsaturated fatty acids