Products

View as table Download

Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%).

Rabbit Polyclonal Anti-ARRB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL

Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M).
Modifications Phospho-specific

Rabbit anti-PRKACB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKACB

CAMK2A rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CaMKII around the phosphorylation site of Threonine 286 (Q-E-Tp-V-D).

CAMK2A rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CaMKII around the phosphorylation site of Threonine 286 (Q-E-Tp-V-D).

GUCY2D (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 540-570 amino acids from the Central region of human GUCY2D / RETGC1

Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E).
Modifications Phospho-specific

Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C).
Modifications Phospho-specific

ADRBK2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADRBK2

CAMK2A pThr286 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat, Xenopus
Immunogen Phosphopeptide corresponding to amino acid residues surrounding the phosphoThr286 found in Rat brain CaM Kinase II.

Mouse Monoclonal anti-CAMK2A Antibody

Applications IHC
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E).
Modifications Phospho-specific

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.

CAMK2B mouse monoclonal antibody, clone S11, Purified

Applications ELISA, IHC, WB
Reactivities Human

CLCA1 mouse monoclonal antibody, clone 1C4, Purified

Applications ELISA, IHC, WB
Reactivities Human

GNAL rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 50-100 of Human Gα olf.

CAMK2G (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Primate, Rat
Immunogen KLH conjugated synthetic peptide between 309-338 amino acids from the C-terminal region of Human CAMK2G (CAMK2 gamma).

cGKI (PRKG1) (beta isoform) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human cGKI beta.

GPR 164 (OR51E1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic human peptide - KLH conjugated

CLCA1 (872-884) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CLCA1

OR1N1 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human
Immunogen OR1N1 antibody was raised against synthetic peptide

OR2B11 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 255-284 amino acids from the C-terminal region of Human OR2B11

OR2T3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 287-316 amino acids from the C-terminal region of human Olfactory receptor 2T3

OR2Z1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 68-96 amino acids from the N-terminal region of Human Olfactory receptor 2Z1

OR9Q1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 282-312 amino acids from the C-terminal region of human Olfactory receptor 9Q1

Rabbit Polyclonal antibody to CLCA1 (chloride channel accessory 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 542 and 633 of CLCA1 (Uniprot ID#A8K7I4)

Rabbit polyclonal PKA CAT (Ab-197) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C).

Rabbit Polyclonal beta-Arrestin 2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1.

CAMK2B rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

cGKI (PRKG1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide - KLH conjugated

GRK3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 36~65 amino acids from the N-terminal region of human ADRBK2

CNGA4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 138-168 amino acids from the N-terminal region of human CNGA4

OR13J1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen conjugated synthetic peptide between 244-272 amino acids from the C-terminal region of human OR13J1

OR14J1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 205-234 amino acids from the C-terminal region of human

OR1J4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 275-303 amino acids from the C-terminal region of human OR1J4

OR4K2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 283-312 amino acids from the C-terminal region of human Olfactory receptor 4K2

OR5L2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human OR5L2

OR8B8 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 283-312 amino acids from the C-terminal region of human Olfactory receptor 8B8

Rabbit Polyclonal antibody to GPR164 (olfactory receptor, family 51, subfamily E, member 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 78 and 170 of GPR164 (Uniprot ID#Q8TCB6)

Rabbit polyclonal anti-GNAL antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GNAL.

Phosphodiesterase 1c / PDE1C Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Horse, Gibbon
Conjugation Unconjugated
Immunogen PDE1C antibody was raised against synthetic 16 amino acid peptide from C-terminus of human PDE1C. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit (100%); Opossum (88%).

OR51E1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Immunogen OR51E1 antibody was raised against synthetic 17 amino acid peptide from internal region of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Marmoset, Mouse, Hamster, Rabbit (88%); Gibbon, Galago, Rat (82%).

Rabbit Polyclonal anti-OR13C9 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR

Rabbit Polyclonal anti-OR13C9 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR

Rabbit polyclonal CaMK2 alpha/beta/delta antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CaMK2a/β/d.

Rabbit polyclonal anti-CALML5 (CABP7) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CALML5.