Products

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 75 results

Page 1 of 2

(reset)

ACAT1 Rabbit Polyclonal Antibody

TA332618

USD 275.00

3 Weeks

Rabbit anti-ACAT1 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ACAT1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

HMGCS1 Rabbit Polyclonal Antibody

TA346705

USD 475.00

5 Days

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1. Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

1 / 2

2 / 2

Previous Next

BDH2 Goat Polyclonal Antibody

TA302431

USD 375.00

In Stock

Goat Polyclonal Antibody against BDH2 / DHRS6 (aa 60 to 71)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-TKKKQIDQFANE, from the internal region of the protein sequence according to NP_064524.3.

1 / 3

2 / 3

3 / 3

Previous Next

ACAT2 Rabbit Polyclonal Antibody

TA331169

USD 310.00

5 Days

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

1 / 2

2 / 2

Previous Next

ACAT1 (N-term) Mouse Monoclonal Antibody [Clone ID: AT1.H11]

AM31905PU-N

USD 440.00

2 Weeks

ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human

ACAT1 Rabbit Polyclonal Antibody

AP31744PU-N

USD 440.00

2 Weeks

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide

ACAT1 Rabbit Polyclonal Antibody

AP31756PU-N

USD 440.00

2 Weeks

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide from Human ACAT1. Epitope: Internal.

1 / 2

2 / 2

Previous Next

HMGCL Rabbit Polyclonal Antibody

TA308677

USD 415.00

5 Days

Rabbit Polyclonal antibody to HMGCL (3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 325 of HMGCL (Uniprot ID#P35914)

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ACAT1 Rabbit Polyclonal Antibody

AP31747PU-N

USD 440.00

2 Weeks

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Porcine, Rat
Immunogen	Synthetic peptide

ACAT1 Rabbit Polyclonal Antibody

TA336252

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

1 / 2

2 / 2

Previous Next

ACAT1 Rabbit Polyclonal Antibody

TA336253

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

1 / 2

2 / 2

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

CF501217

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

CF501219

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF501220

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

CF501221

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

CF501222

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF501223

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

CF501224

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF501225

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1B7]

CF501238

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

BDH2 Mouse Monoclonal Antibody [Clone ID: OTI4G4]

CF501291

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

BDH2 Mouse Monoclonal Antibody [Clone ID: OTI3G10]

CF501292

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

BDH2 Mouse Monoclonal Antibody [Clone ID: OTI2G1]

CF501293

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

BDH1 Rabbit Polyclonal Antibody

TA349708

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-BDH1 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human BDH1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

HMGCL Rabbit Polyclonal Antibody

TA350049

USD 345.00

In Stock

Rabbit Polyclonal Anti-HMGCL Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human HMGCL

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HMGCS1 Rabbit Polyclonal Antibody

TA351250

USD 345.00

In Stock

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human HMGCS1

HMGCS2 Rabbit Polyclonal Antibody

TA351251

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human HMGCS2

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A11]

TA501217AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]

TA501217BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

TA501219

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]

TA501219AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F7]

TA501219BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

TA501219S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA501220

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]

TA501220AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

TA501220BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA501220S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

TA501221

USD 379.00

In Stock

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B1]

TA501221AM

USD 420.00

4 Weeks

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B1]

TA501221BM

USD 420.00

4 Weeks

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

TA501221S

USD 159.00

2 Days

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

TA501222

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E2]

TA501222AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E2]

TA501222BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

TA501222S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

TA501223

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C9]

TA501223AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C9]

TA501223BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

1 - 50 of 75 results

Page 1 of 2