Rabbit anti-CBX5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBX5 |
Rabbit anti-CBX5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBX5 |
Rabbit Polyclonal HP1alpha/beta/gamma Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HP1.,.,. antibody: human HP1 . (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the . and . isoforms. |
Rabbit Polyclonal HP1alpha Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HP1. antibody: human HP1. (Heterochromatin protein 1 homolog alpha), using the full length recombinant GST tagged protein. |
Rabbit polyclonal HP1 alpha (Ab-92) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HP1 alpha around the phosphorylation site of serine 92 (R-K-SP-N-F). |
Rabbit Polyclonal HP1 alpha Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HP1 alpha antibody: human HP1 alpha (Heterochromatin protein 1 homolog alpha), using the full length recombinant GST tagged protein. |
Rabbit Polyclonal HP1 alpha, beta and gamma Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HP1 alpha, beta and gamma antibody: human HP1 beta (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the alpha and gamma isoforms. |
Rabbit polyclonal CBX5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CBX5. |
Goat Polyclonal Antibody against CBX5 / HP1-Alpha
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NKRKSNFSNSADDIK, from the internal region of the protein sequence according to NP_036249.1. |
Rabbit Polyclonal Anti-CBX5 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5. Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE |
Rabbit Polyclonal Antibody against HP 1 alpha
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide containing an N-terminal region of human HP 1 alpha (within residues 1-100). [Swiss-Prot P45973] |
Anti-CBX5 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-CBX5 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
HP1 alpha/CBX5 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1). |
Modifications | Unmodified |
HP1 alpha/CBX5 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1). |
Modifications | Unmodified |
HP1 alpha (1E8) Mouse monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HP1 alpha Mouse monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HP1 alpha Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human HP1 alpha |