Germany
Japan
United Kingdom
China
NSE (ENO2) mouse monoclonal antibody, clone AT17D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Products
View as table Download
MTREX (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human SKIV2L2 |
USD 450.00
2 Weeks
CCR4 NOT transcription complex subunit 3 (CNOT3) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 142-171 amino acids from the N-terminal region of human CNOT3 |
Rabbit Polyclonal antibody to Edc3 (enhancer of mRNA decapping 3 homolog (S. cerevisiae))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 127 and 376 of Edc3 (Uniprot ID#Q96F86) |
Anti-ENO3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.49~53(L-R-D-G-D) derived from Human β-Enolase(ENO-3). |
Rabbit Polyclonal Anti-CNOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG |
Rabbit Polyclonal Anti-CNOT6L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT6L antibody is: synthetic peptide directed towards the middle region of Human CNOT6L. Synthetic peptide located within the following region: AKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLN |
Rabbit Polyclonal Anti-DDX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL |
Rabbit Polyclonal Anti-DDX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ |
CNOT8 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 32-60 amino acids from the N-terminal region of human CNOT8 |
Grp75 (HSPA9) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 280-309 amino acids from the Central region of human Grp75 / HSPA9 |
LSM7 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 52-80 amino acids from the C-terminal region of human LSM7 |
MPP6 (MPHOSPH6) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MPHOSPH6 |
Rabbit Polyclonal Antibody against CNOT4 (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CNOT4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-84 amino acids from the N-terminal region of human CNOT4. |
Goat Polyclonal Antibody against DCP1A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QVLTKNKDNHN, from the C Terminus of the protein sequence according to NP_060873.3. |
Goat Anti-C1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKNASKVANKGKSKS, from the C Terminus of the protein sequence according to NP_775269.1. |
Goat Anti-PMSCL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RTQTTSAKQEKAP, from the C-Terminus of the protein sequence according to NP_001029366.1; NP_005024.2. |
Rabbit Polyclonal CNOT4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CNOT4 antibody was raised against a 19 amino acid peptide near the amino terminus of the human CNOT4. |
Rabbit anti-DCP2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit anti-Dcp1a polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Goat Anti-LSM2 (aa33-46) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DQYLNIKLTDISVT, from the internal region of the protein sequence according to NP_067000.1. |
Anti-HSPA9 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 70kDa protein 9 (mortalin) |
Rabbit polyclonal Hsp60 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human Hsp60 produced through recombinant DNA methods in E.coli |
Rabbit anti-ENO2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ENO2 |
Rabbit polyclonal anti-EXOSC2 antibody(N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EXOSC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EXOSC2. |
Rabbit Polyclonal Anti-CNOT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT7 antibody: synthetic peptide directed towards the middle region of human CNOT7. Synthetic peptide located within the following region: LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG |
Rabbit Polyclonal Anti-WDR61 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-WDR61 antibody is: synthetic peptide directed towards the N-terminal region of Human WDR61. Synthetic peptide located within the following region: AIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGV |
Rabbit Polyclonal Anti-CNOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS |
Rabbit Polyclonal Anti-LSM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LSM5 Antibody is: synthetic peptide directed towards the middle region of Human LSM5. Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV |
Rabbit Polyclonal Anti-EDC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EDC4 antibody: synthetic peptide directed towards the N terminal of human EDC4. Synthetic peptide located within the following region: LQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPV |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR |
Rabbit Polyclonal Anti-CNOT10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT10 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNOT10. Synthetic peptide located within the following region: NVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLF |
Rabbit Polyclonal Anti-CNOT10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT10 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNOT10. Synthetic peptide located within the following region: AMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAAS |
USD 375.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT3 Antibody: synthetic peptide directed towards the N terminal of human CNOT3. Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML |
USD 310.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT3 Antibody: synthetic peptide directed towards the N terminal of human CNOT3. Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML |
Active filters
Applications
- WB
Pathways
- RNA degradation
Filter by
Category
Target Symbol
- CNOT4 (70)
- HSPD1 (51)
- PARN (48)
- EXOSC7 (37)
- WDR61 (28)
- DCP1B (27)
- LSM1 (26)
- HSPA9 (24)
- ENO2 (21)
- EXOSC1 (20)
- DDX6 (19)
- C1D (18)
- EXOSC3 (14)
- CNOT2 (13)
- ENO1 (13)
- DCPS (10)
- DCP1A (8)
- XRN2 (7)
- ENO3 (6)
- DCP2 (5)
- CNOT3 (4)
- CNOT7 (4)
- DIS3 (4)
- EXOSC2 (3)
- EXOSC9 (3)
- PNPT1 (3)
- CNOT10 (2)
- CNOT8 (2)
- EDC3 (2)
- EXOSC10 (2)
- EXOSC6 (2)
- LSM2 (2)
- LSM4 (2)
- LSM6 (2)
- MTREX (2)
- PAPOLA (2)
- PAPOLB (2)
- SKIV2L (2)
- CNOT6 (1)
- CNOT6L (1)
- CNOT9 (1)
- EDC4 (1)
- EXOSC4 (1)
- LSM5 (1)
- LSM7 (1)
- LSM8 (1)
- MPHOSPH6 (1)
- PAPOLG (1)
- PATL1 (1)
- SKIV2L2 (1)
- TENT4A (1)
- XRN1 (1)
- ZCCHC7 (1)
Reactivities
- Human (492)
- Mouse (395)
- Rat (364)
- Dog (47)
- Monkey (45)
- Bovine (9)
- Chicken (8)
- Hamster (6)
- Xenopus (4)
- Canine (3)
- Pig (3)
- Primate (3)
- Rabbit (3)
- Cow (2)
- Guinea Pig (2)
- Chimpanzee (1)
- Drosophila (1)
- Escherichia coli (1)
- Helicobacter pylori (1)
- Rhesus Monkey (1)
- Salmonella Typhimurium (1)
- Sheep (1)
- Spinach (1)
- Trichinella spiralis (1)
- White Fly (1)
- X. tropicalis (1)
- Yeast (1)
- Zebrafish (1)