Products

View as table Download

Mouse Monoclonal H3K27me3 Antibody

Applications ELISA, IF, WB
Reactivities Human

Mouse Monoclonal H3K4me3 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Rabbit Polyclonal H3K9me3 Antibody

Applications Assay, Dot, ELISA, IF, WB
Reactivities Human, Mouse
Immunogen The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide.

Rabbit polyclonal Histone H3 (Ab-28) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P).

Rabbit polyclonal anti-Histone H3.1 (Ser10) antibody (Phospho-specific)

Applications IHC, WB
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Histone H3.1 around the phosphorylation site of serine 10 (R-K-SP-T-G).
Modifications Phospho-specific

Mouse Monoclonal H3K4me1 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Mouse Monoclonal H3K4me2 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Mouse Monoclonal H3K9me2 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Rabbit Polyclonal H3K4me3 Antibody

Applications Assay, Dot, ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide.

Mouse Monoclonal H3K9un Antibody

Applications Assay, IF, WB
Reactivities Human

Rabbit Polyclonal H3K23ac Antibody

Applications Dot, ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-H3K23ac antibody: histone H3 containing the acetylated lysine 23 (H3K23ac), using a KLH-conjugated synthetic peptide.

H3FA (HIST1H3A) pThr3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) pSer28 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) pSer10 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal Histone H3 (Ab-3) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of threonine 3 (A-R-TP-K-Q).

Rabbit polyclonal Histone H3 (Thr3) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Histone H3 around the phosphorylation site of threonine 3 (A-R-TP-K-Q).
Modifications Phospho-specific

Mouse Monoclonal H3K27me2/3 Antibody

Applications Dot, WB
Reactivities Human

Rabbit polyclonal Histone H3 (Ser28) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P).
Modifications Phospho-specific

Rabbit polyclonal Histone H3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Histone-3 was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to the c-terminus region of human histone-3.

Anti-HIST1H3A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide (KLH-coupled) derived from human HIST1H3A

Rabbit Polyclonal Anti-HIST1H3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIST1H3A antibody: synthetic peptide directed towards the N terminal of human HIST1H3A. Synthetic peptide located within the following region: KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR

Rabbit anti Histone H3 (pSer10) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing -QTARKSTGGKA-with phosphorylated serine 10 of human Histone H3.