Mouse Monoclonal H3K27me3 Antibody
Applications | ELISA, IF, WB |
Reactivities | Human |
Mouse Monoclonal H3K27me3 Antibody
Applications | ELISA, IF, WB |
Reactivities | Human |
Mouse Monoclonal H3K4me3 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Rabbit Polyclonal H3K9me3 Antibody
Applications | Assay, Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Immunogen | The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide. |
Rabbit polyclonal Histone H3 (Ab-28) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P). |
Rabbit polyclonal anti-Histone H3.1 (Ser10) antibody (Phospho-specific)
Applications | IHC, WB |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histone H3.1 around the phosphorylation site of serine 10 (R-K-SP-T-G). |
Modifications | Phospho-specific |
Mouse Monoclonal H3K4me1 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Mouse Monoclonal H3K4me2 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Mouse Monoclonal H3K9me2 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Rabbit Polyclonal H3K4me3 Antibody
Applications | Assay, Dot, ELISA, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
Mouse Monoclonal H3K9un Antibody
Applications | Assay, IF, WB |
Reactivities | Human |
Rabbit Polyclonal H3K23ac Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-H3K23ac antibody: histone H3 containing the acetylated lysine 23 (H3K23ac), using a KLH-conjugated synthetic peptide. |
H3FA (HIST1H3A) pThr3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
H3FA (HIST1H3A) pSer28 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
H3FA (HIST1H3A) pSer10 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal Histone H3 (Ab-3) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of threonine 3 (A-R-TP-K-Q). |
Rabbit polyclonal Histone H3 (Thr3) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histone H3 around the phosphorylation site of threonine 3 (A-R-TP-K-Q). |
Modifications | Phospho-specific |
Mouse Monoclonal H3K27me2/3 Antibody
Applications | Dot, WB |
Reactivities | Human |
Rabbit polyclonal Histone H3 (Ser28) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P). |
Modifications | Phospho-specific |
Rabbit polyclonal Histone H3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Histone-3 was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to the c-terminus region of human histone-3. |
Anti-HIST1H3A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide (KLH-coupled) derived from human HIST1H3A |
Rabbit Polyclonal Anti-HIST1H3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIST1H3A antibody: synthetic peptide directed towards the N terminal of human HIST1H3A. Synthetic peptide located within the following region: KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR |
Rabbit anti Histone H3 (pSer10) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide containing -QTARKSTGGKA-with phosphorylated serine 10 of human Histone H3. |