Products

cDNA Clones (46)
Antibodies (19)
Proteins (17)
Jump to Filters
View as table Download
PP1C gamma (PPP1CC) (NM_002710) Human Tagged ORF Clone
RC204158

USD 420.00

In Stock

PPP1CC (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, gamma isozyme (PPP1CC)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Tagged ORF Clone
RC201142

USD 98.00

USD 470.00

In Stock

PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PTP1B (PTPN1) (NM_002827) Human Tagged ORF Clone
RC204902

USD 420.00

In Stock

PTPN1 (Myc-DDK-tagged)-Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP1A (PPP1CA) (NM_002708) Human Tagged ORF Clone
RC203575

USD 420.00

In Stock

PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone
RC200092

USD 98.00

USD 560.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP1A (PPP1CA) (NM_001008709) Human Tagged ORF Clone
RC212268

USD 420.00

In Stock

PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone
RC212090

USD 420.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP1R3A (NM_002711) Human Tagged ORF Clone
RC215004

USD 600.00

In Stock

PPP1R3A (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 3A (PPP1R3A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Protein Phosphatase 1 beta (PPP1CB) (NM_002709) Human Tagged ORF Clone
RC215893

USD 420.00

In Stock

PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP1R3B (NM_024607) Human Tagged ORF Clone
RC208158

USD 420.00

In Stock

PPP1R3B (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 3B (PPP1R3B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone
RC227852

USD 420.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Recombinant Protein
TP301142

USD 823.00

In Stock

Recombinant protein of human protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

PTP1B (PTPN1) (NM_002827) Human Untagged Clone
SC110989

USD 310.00

In Stock

PTPN1 (untagged)-Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
LAR (PTPRF) (NM_002840) Human Tagged ORF Clone
RC224381

USD 1,999.00

In Stock

PTPRF (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, F (PTPRF), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PTP1B (PTPN1) (NM_002827) Human Tagged ORF Clone
RG204902

USD 460.00

In Stock

PTPN1 (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Protein Phosphatase 1 beta (PPP1CB) (NM_002709) Human Tagged ORF Clone
RG215893

USD 460.00

In Stock

PPP1CB (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Tagged ORF Clone
RG201142

USD 460.00

In Stock

PPP1CB (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP1A (PPP1CA) (NM_002708) Human Tagged ORF Clone
RG203575

USD 460.00

In Stock

PPP1CA (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP1A (PPP1CA) (NM_002708) Human Untagged Clone
SC319185

USD 310.00

In Stock

PPP1CA (untagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone
RG200092

USD 460.00

In Stock

INPP5K (GFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PP1C gamma (PPP1CC) (NM_002710) Human Tagged ORF Clone
RG204158

USD 460.00

In Stock

PPP1CC (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, gamma isozyme (PPP1CC)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP1R3B (NM_024607) Human Tagged ORF Clone
RG208158

USD 460.00

In Stock

PPP1R3B (GFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 3B (PPP1R3B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP1A (PPP1CA) (NM_001008709) Human Tagged ORF Clone
RG212268

USD 460.00

In Stock

PPP1CA (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP1R3A (NM_002711) Human Tagged ORF Clone
RG215004

USD 660.00

In Stock

PPP1R3A (GFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 3A (PPP1R3A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP1A (PPP1CA) (NM_206873) Human Tagged ORF Clone
RG216212

USD 460.00

In Stock

PPP1CA (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP1A (PPP1CA) (NM_002708) Human Tagged ORF Clone
RC203575L4

USD 620.00

In Stock

Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PP1C gamma (PPP1CC) (NM_002710) Human Untagged Clone
SC319906

USD 310.00

In Stock

PPP1CC (untagged)-Human protein phosphatase 1, catalytic subunit, gamma isozyme (PPP1CC)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
LAR (PTPRF) (NM_130440) Human Untagged Clone
SC128009

USD 310.00

In Stock

PTPRF (untagged)-Human protein tyrosine phosphatase, receptor type, F (PTPRF), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Tagged ORF Clone
RC201142L1

USD 768.00

In Stock

Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PTP1B (PTPN1) (NM_002827) Human Tagged ORF Clone
RC204902L1

USD 768.00

In Stock

Lenti ORF clone of Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PPP1R3A (NM_002711) Human Tagged ORF Clone
RC215004L1

USD 984.00

In Stock

Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 3A (PPP1R3A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LAR (PTPRF) (NM_002840) Human Tagged Lenti ORF Clone
RC224381L1

USD 2,724.00

In Stock

Lenti ORF clone of Human protein tyrosine phosphatase, receptor type, F (PTPRF), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PPP1A (PPP1CA) (NM_002708) Human Recombinant Protein
TP760285

USD 215.00

In Stock

Recombinant protein of human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
Protein Phosphatase 1 beta (PPP1CB) (NM_002709) Human Untagged Clone
SC118477

USD 310.00

In Stock

PPP1CB (untagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PPP1R3D (NM_006242) Human Untagged Clone
SC125491

USD 310.00

In Stock

PPP1R3D (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 3D (PPP1R3D)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SKIP (INPP5K) Rabbit Polyclonal Antibody
TA343120

USD 375.00

In Stock

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF
SKIP (INPP5K) (NM_016532) Human Tagged Lenti ORF Clone
RC200092L1

USD 768.00

In Stock

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PTP1B (PTPN1) (NM_002827) Human Tagged ORF Clone
RC204902L4

USD 768.00

In Stock

Lenti ORF clone of Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Phosphatase 1 beta (PPP1CB) (NM_002709) Human Tagged ORF Clone
RC215893L1

USD 768.00

In Stock

Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PTP1B (PTPN1) (NM_002827) Human Recombinant Protein
TP750046

USD 425.00

In Stock

Recombinant protein of human protein tyrosine phosphatase, non-receptor type 1 (PTPN1) produced in E. coli.

Tag N-His
Expression Host E. coli
PPP1R3B (NM_024607) Human Untagged Clone
SC112117

USD 310.00

In Stock

PPP1R3B (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 3B (PPP1R3B), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody
TA308937

USD 415.00

In Stock

Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873)
PTP1B (PTPN1) (NM_002827) Human Recombinant Protein
TP710202

USD 425.00

In Stock

Purified recombinant protein of Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), full length, with C-terminal DDK tag, expressed in sf9, 20ug

Tag C-DDK
Expression Host Sf9
PPP1A (PPP1CA) (NM_002708) Human Tagged ORF Clone
RC203575L1

USD 620.00

In Stock

Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®