Germany
Japan
United Kingdom
China
USD 98.00
USD 390.00
In Stock
PSPH (Myc-DDK-tagged)-Human phosphoserine phosphatase (PSPH)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
MTMR1 (Myc-DDK-tagged)-Human myotubularin related protein 1 (MTMR1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
MTMR6 (Myc-DDK-tagged)-Human myotubularin related protein 6 (MTMR6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
MTMR2 (Myc-DDK-tagged)-Human myotubularin related protein 2 (MTMR2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SYNJ2 (Myc-DDK-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
MTMR7 (Myc-DDK-tagged)-Human myotubularin related protein 7 (MTMR7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
MTMR2 (Myc-DDK-tagged)-Human myotubularin related protein 2 (MTMR2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SYNJ1 (Myc-DDK-tagged)-Human synaptojanin 1 (SYNJ1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human myotubularin related protein 6 (MTMR6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human phosphoserine phosphatase (PSPH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
INPP5K (GFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MTMR2 (GFP-tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSPH (GFP-tagged) - Human phosphoserine phosphatase (PSPH)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MTMR2 (GFP-tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SYNJ2 (GFP-tagged) - Human synaptojanin 2 (SYNJ2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MTMR7 (GFP-tagged) - Human myotubularin related protein 7 (MTMR7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human myotubularin related protein 6 (MTMR6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human phosphoserine phosphatase (PSPH), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human myotubularin related protein 2 (MTMR2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MTMR2 (untagged)-Human myotubularin related protein 2 (MTMR2), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PSPH (untagged)-Human phosphoserine phosphatase (PSPH)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
INPP5K (untagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC321576 is the updated version of SC128048.
MTMR2 (untagged)-Human myotubularin related protein 2 (MTMR2), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC127468 is the updated version of SC128027.
MTMR1 (untagged)-Human myotubularin related protein 1 (MTMR1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SYNJ1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MTMR2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MTMR2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
In Stock
PSPH HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SYNJ2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MTMR2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of myotubularin related protein 1 (MTMR1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
INPP5K (untagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SYNJ2 (untagged)-Human synaptojanin 2 (SYNJ2), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SYNJ1 (untagged)-Human synaptojanin 1 (SYNJ1), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MTMR7 (untagged)-Human myotubularin related protein 7 (MTMR7)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MTMR7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MTMR7 |
Active filters
Families
- Phosphatase
Pathways
- Metabolic pathways
Availabilities
- In Stock