CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700027 |
CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700027 |
ICOS Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ICOS |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
Applications | FC, IHC |
Reactivities | Guinea Pig |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
CD40 mouse monoclonal antibody, clone B-B20, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD40 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Mouse Anti-Human CD40 Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
Rabbit Polyclonal Anti-CD8A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human, Monkey |
Rabbit Polyclonal Antibody against CD8A (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7
Applications | FC, IHC |
Reactivities | Human |
Conjugation | APC-Cy7 |
CD8A mouse monoclonal antibody, clone RFT-8, Cy5
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Cy5 |
CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, Purified
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE-Cy5.5 |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE-Cy7 |
CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified
Applications | IHC, IP |
Reactivities | Human, Rat |
CD8A mouse monoclonal antibody, clone B-Z31, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Purified
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone MCD8, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
CD8A mouse monoclonal antibody, clone MEM-87, Purified
Applications | FC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone MEM-31, Purified
Applications | FC, IP |
Reactivities | Human |
Mouse Monoclonal CD8 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD8A mouse monoclonal antibody, clone 17D8, APC
Applications | FC |
Reactivities | Human |
Conjugation | APC |
CD8A mouse monoclonal antibody, clone RFT-8, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
CD8A mouse monoclonal antibody, clone RFT-8, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD8A mouse monoclonal antibody, clone RFT-8, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD8A mouse monoclonal antibody, clone RFT-8, PE-TXRD
Applications | FC |
Reactivities | Human |
Conjugation | PE-TXRD |
CD40 mouse monoclonal antibody, clone B-B20, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
CD40 mouse monoclonal antibody, clone B-B20, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD40 mouse monoclonal antibody, clone B-B20, Purified
Applications | FC |
Reactivities | Human |
CD40 mouse monoclonal antibody, clone B-B20, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Purified
Applications | FC |
Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD8A mouse monoclonal antibody, clone B-Z31, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |