COL5A1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human COL5A1 |
COL5A1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human COL5A1 |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type V purified from Human and Bovine placenta |
Collagen V (COL5A1) goat polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Human type V collagen |
Collagen V (COL5A1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, R |
Reactivities | Chicken |
Immunogen | Purified collagen type IV from chicken skin |
Col5a1 rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, R |
Reactivities | Bovine, Mouse, Rat |
Immunogen | Purified collagen type V from Rat skin. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, R |
Reactivities | Human |
Immunogen | Purified collagen type V from Human placenta |
Collagen V (COL5A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Biotin |
Immunogen | Collagen Type V from Human and Bovine placenta. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit polyclonal Collagen V a1 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen V a1. |
Rabbit Polyclonal Anti-Collagen Valpha 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Collagen Valpha 1 Antibody: A synthesized peptide derived from human Collagen Valpha 1 |
Collagen V (COL5A1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 54-82 amino acids from the N-terminal region of human COL5A1 |
Anti-COL5A1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 69-82 amino acids of human collagen, type V, alpha 1 |
Col5a1 rabbit polyclonal antibody, Purified
Applications | ELISA, IF |
Reactivities | Rat |
Immunogen | Collagen type V extracted and purified from rat skin. |
Rabbit Polyclonal Anti-COL5A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COL5A1 antibody: synthetic peptide directed towards the N terminal of human COL5A1. Synthetic peptide located within the following region: PGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPG |
COL5A1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human COL5A1 |