Germany
Japan
United Kingdom
China
HSPA9 (Myc-DDK-tagged)-Human heat shock 70kDa protein 9 (mortalin) (HSPA9), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CNOT4 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
ENO1 (Myc-DDK-tagged)-Human enolase 1, (alpha) (ENO1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
DCP1A (Myc-DDK-tagged)-Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
EXOSC3 (Myc-DDK-tagged)-Human exosome component 3 (EXOSC3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
HSPD1 (Myc-DDK-tagged)-Human heat shock 60kDa protein 1 (chaperonin) (HSPD1), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
CNOT3 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 3 (CNOT3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
PARN (Myc-DDK-tagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
HSPD1 (untagged)-Human heat shock 60kDa protein 1 (chaperonin) (HSPD1), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ENO1 (untagged)-Human enolase 1, (alpha) (ENO1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
DDX6 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 (DDX6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PAPD7 (Myc-DDK-tagged)-Human PAP associated domain containing 7 (PAPD7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CNOT6L (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ENO3 (untagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ENO2 (untagged)-Human enolase 2 (gamma, neuronal) (ENO2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-RQCD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK |
PARN (untagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Active filters
Pathways
- RNA degradation
Citations
- Yes