Germany
Japan
United Kingdom
China
Lenti ORF clone of Human methyl-CpG binding domain protein 1 (MBD1), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Products
View as table Download
Rabbit Polyclonal MBD1 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: human MBD1 (Methyl-CpG-binding domain protein 1), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein. |
MBD1 (untagged)-Human methyl-CpG binding domain protein 1 (MBD1), transcript variant 3
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the C terminal of human MBD1. Synthetic peptide located within the following region: VKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRD |
Rabbit Polyclonal Anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the middle region of human MBD1. Synthetic peptide located within the following region: CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ |
Lenti ORF clone of Human methyl-CpG binding domain protein 1 (MBD1), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MBD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MBD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of methyl-CpG binding domain protein 1 (MBD1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of methyl-CpG binding domain protein 1 (MBD1), transcript variant PCM1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MBD1 (untagged)-Human methyl-CpG binding domain protein 1 (MBD1), transcript variant 4
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-MBD1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 594 of human MBD1 |
MBD1 (untagged)-Human methyl-CpG binding domain protein 1 (MBD1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the C terminal of human MBD1. Synthetic peptide located within the following region: NKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKP |
Carrier-free (BSA/glycerol-free) MBD1 mouse monoclonal antibody,clone OTI1A1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MBD1 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MBD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MBD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of methyl-CpG binding domain protein 1 (MBD1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of methyl-CpG binding domain protein 1 (MBD1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MBD1 (untagged)-Human methyl-CpG binding domain protein 1 (MBD1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MBD1 (untagged)-Human methyl-CpG binding domain protein 1 (MBD1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 6
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 7
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 8
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 14
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 9
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 10
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 11
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 12
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 (untagged) - Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 13
| Vector | pCMV6 series |
| Tag | Tag Free |
MBD1 mouse monoclonal antibody,clone OTI1A1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MBD1 mouse monoclonal antibody,clone OTI1A1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MBD1 mouse monoclonal antibody,clone OTI1A1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MBD1 mouse monoclonal antibody,clone OTI1A1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MBD1 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MBD1 mouse monoclonal antibody,clone OTI2D7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MBD1 mouse monoclonal antibody,clone OTI2D7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MBD1 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MBD1 |
Rabbit Polyclonal anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MBD1 |
Transient overexpression of MBD1 (NM_015844) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MBD1 (NM_015846) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MBD1 (NM_015845) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- MBD1
Families
- Druggable Genome