Products

Antibodies (36)
cDNA Clones (18)
Proteins (15)
Jump to Filters
View as table Download
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone
RC204895

USD 118.00

USD 429.00

In Stock

CDKN2B (Myc-DDK-tagged)-Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone Lentiviral Particle
RC204895L2V

USD 1,020.00

3 Weeks

Lenti ORF particles, CDKN2B (mGFP-tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone Lentiviral Particle
RC204895L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, CDKN2B (mGFP-tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone Lentiviral Particle
RC204895L1V

USD 1,020.00

3 Weeks

Lenti ORF particles, CDKN2B (Myc-DDK tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone Lentiviral Particle
RC204895L3V

USD 1,020.00

6 Weeks

Lenti ORF particles, CDKN2B (Myc-DDK tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p15 INK4b (CDKN2B) (NM_078487) Human Tagged ORF Clone
RC217024

USD 98.00

USD 390.00

In Stock

CDKN2B (Myc-DDK-tagged)-Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone
RG204895

USD 460.00

3 Weeks

CDKN2B (GFP-tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA312926

USD 345.00

4 Weeks

Rabbit polyclonal anti-p15 INK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p15 INK antibody.
p15 INK4b (CDKN2B) (NM_078487) Human Tagged ORF Clone
RC217024L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p15 INK4b (CDKN2B) (NM_078487) Human Tagged ORF Clone Lentiviral Particle
RC217024L3V

USD 820.00

6 Weeks

Lenti ORF particles, CDKN2B (Myc-DDK tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p15 INK4b (CDKN2B) (NM_078487) Human Tagged ORF Clone
RC217024L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p15 INK4b (CDKN2B) (NM_078487) Human Tagged ORF Clone Lentiviral Particle
RC217024L4V

USD 820.00

6 Weeks

Lenti ORF particles, CDKN2B (mGFP-tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p15 INK4b (CDKN2B) (NM_078487) Human Tagged ORF Clone
RG217024

USD 460.00

3 Weeks

CDKN2B (GFP-tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
p15 INK4b (CDKN2B) (NM_004936) Human Untagged Clone
SC319536

USD 310.00

In Stock

CDKN2B (untagged)-Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone
RC204895L1

USD 768.00

In Stock

Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone
RC204895L2

USD 768.00

In Stock

Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone
RC204895L4

USD 768.00

In Stock

Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA348038

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p15 INK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p15 INK Antibody: A synthesized peptide derived from human p15 INK
p15 INK4b (CDKN2B) (NM_078487) Human Over-expression Lysate
LY409193

USD 396.00

5 Days

Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY409193 is the same product as LY429931.
p15 INK4b (CDKN2B) (NM_078487) Human Untagged Clone
SC120261

USD 420.00

In Stock

CDKN2B (untagged)-Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA347448

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p15 INK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p15 INK Antibody: A synthesized peptide derived from human p15 INK
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
AP06261PU-N

USD 370.00

2 Weeks

p15 INK4b (CDKN2B) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human p15 INK4b.
p15 INK4b (CDKN2B) (NM_004936) Human Over-expression Lysate
LY417638

USD 396.00

In Stock

Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone
RC204895L3

USD 768.00

3 Weeks

Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p15 INK4b (CDKN2B) (NM_004936) Human Over-expression Lysate
LC417638

USD 121.00

In Stock

CDKN2B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA330369

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDKN2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDKN2B antibody: synthetic peptide directed towards the middle region of human CDKN2B. Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA354868

USD 355.00

5 Days

Rabbit anti p15INK4b Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI3E4]
CF505166

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDKN2B mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF505201

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDKN2B mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI7C4]
CF505205

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDKN2B mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI3B6]
CF505206

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDKN2B mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI8H4]
CF505208

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDKN2B mouse monoclonal antibody, clone OTI8H4 (formerly 8H4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI1H5]
CF505209

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDKN2B mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) (NM_078487) Human Over-expression Lysate
LC409193

USD 121.00

2 Weeks

CDKN2B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
p15 INK4b (CDKN2B) (NM_078487) Human Over-expression Lysate
LC429931

USD 121.00

2 Weeks

CDKN2B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
p15 INK4b (CDKN2B) (NM_078487) Human Over-expression Lysate
LY429931

USD 396.00

5 Days

Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
p15 INK4b (CDKN2B) (NM_004936) Human Mass Spec Standard
PH304895

USD 2,055.00

3 Weeks

CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_004927)

Tag C-Myc/DDK
Expression Host HEK293
p15 INK4b (CDKN2B) (NM_078487) Human Mass Spec Standard
PH317024

USD 2,055.00

3 Weeks

CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_511042)

Tag C-Myc/DDK
Expression Host HEK293
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI3E4]
TA505166

USD 379.00

In Stock

CDKN2B (p15 INK4b) mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI3E4]
TA505166S

USD 159.00

2 Days

CDKN2B (p15 INK4b) mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA505201

USD 379.00

In Stock

CDKN2B (p15 INK4b) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA505201S

USD 159.00

2 Days

CDKN2B (p15 INK4b) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p15 INK4b (CDKN2B) Mouse Monoclonal Antibody [Clone ID: OTI7C4]
TA505205

USD 379.00

In Stock

CDKN2B (p15 INK4b) mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated