C5AR1 (Myc-DDK-tagged)-Human complement component 5a receptor 1 (C5AR1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
C5AR1 (Myc-DDK-tagged)-Human complement component 5a receptor 1 (C5AR1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human complement component 5a receptor 1 (C5AR1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
C5AR1 (GFP-tagged) - Human complement component 5a receptor 1 (C5AR1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, C5AR1 (Myc-DDK tagged) - Human complement component 5a receptor 1 (C5AR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, C5AR1 (mGFP-tagged) - Human complement component 5a receptor 1 (C5AR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, C5AR1 (Myc-DDK tagged) - Human complement component 5a receptor 1 (C5AR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, C5AR1 (mGFP-tagged) - Human complement component 5a receptor 1 (C5AR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
C5AR1 (untagged)-Human complement component 5a receptor 1 (C5AR1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human complement component 5a receptor 1 (C5AR1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
C5AR1 (untagged)-Human complement component 5a receptor 1 (C5AR1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of complement component 5a receptor 1 (C5AR1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
C5R1 (C5AR1) mouse monoclonal antibody, clone 3H1738, Purified
Applications | FC, FN, IHC, NEUT |
Reactivities | Human, Rabbit |
Lenti ORF clone of Human complement component 5a receptor 1 (C5AR1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
C5R1 (C5AR1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human C5AR1 |
C5AR1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-C5a Anaphylatoxin Receptor (extracellular)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DKDTLDLNTPVDK, corresponding to amino acid residues 16-28 of human C5aR (Accession P21730 ). Extracellular, N-terminus. |
Rabbit Polyclonal Anti-C5AR1 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | C5AR1 / CD88 / C5a Receptor antibody was raised against synthetic 18 amino acid peptide from internal region of human C5AR1 / CD88. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Gibbon (89%). |
C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, Purified
Applications | FC |
Reactivities | Human |
C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
Rabbit Polyclonal Anti-C5AR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK |
C5AR1 MS Standard C13 and N15-labeled recombinant protein (NP_001727)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of C5AR1 (NM_001736) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of C5AR1 (NM_001736) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of C5AR1 (NM_001736) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack