CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK2A1 (untagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 820.00
6 Weeks
Lenti ORF particles, CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CSNK2A1 (GFP-tagged) - Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK2A1 (GFP-tagged) - Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CSNK2A1 (GFP-tagged) - Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CSNK2A1 (untagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CSNK2A1 (untagged)-Kinase deficient mutant (K68M) of Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CSNK2A1 (untagged)-Kinase deficient mutant (K68M) of Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Recombinant protein of human casein kinase 2, alpha 1 polypeptide (CSNK2A1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Lenti-ORF clone of CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CKII alpha (CSNK2A1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Casein kinase II subunit alpha (1-391, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
CSNK2A1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal CKII alpha (CSNK2A1) Antibody (Center)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CKII alpha (CSNK2A1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-269 amino acids from the Central region of human CKII alpha (CSNK2A1). |
CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around phosphorylation site of Threonine 360/Serine 362 |
CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around phosphorylation site of Threonine 360/Serine 362 |
CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around aa. 353~357 |
CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around aa. 353~357 |
Phospho-CSNK2A1-T360/S362 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T360/S362 of human CSNK2A1 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CSNK2A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSNK2A1 antibody: synthetic peptide directed towards the middle region of human CSNK2A1. Synthetic peptide located within the following region: LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP |
Casein kinase II subunit alpha (1-391, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Casein kinase II subunit alpha (1-391, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Casein kinase II subunit alpha (1-391, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
CSNK2A1 MS Standard C13 and N15-labeled recombinant protein (NP_001886)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CSNK2A1 (untagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Anti-CSNK2A1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 39-324 amino acids of human casein kinase 2, alpha 1 polypeptide |
Anti-CSNK2A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 39-324 amino acids of human casein kinase 2, alpha 1 polypeptide |
Transient overexpression of CSNK2A1 (NM_177560) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CSNK2A1 (NM_177559) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CSNK2A1 (NM_001895) in HEK293T cells paraffin embedded controls for ICC/IHC staining