ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ANAPC7 (Myc-DDK tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ANAPC7 (mGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 900.00
6 Weeks
Lenti ORF particles, ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ANAPC7 (mGFP-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 900.00
6 Weeks
Lenti ORF particles, ANAPC7 (mGFP-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ANAPC7 (GFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ANAPC7 (GFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ANAPC7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Apc7 (ANAPC7) (C-term) rabbit polyclonal antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | ANAPC7 antibody was raised against synthetic peptide - KLH conjugated |
ANAPC7 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal APC7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC7 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human APC7. |
ANAPC7 MS Standard C13 and N15-labeled recombinant protein (NP_057322)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7) transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of ANAPC7 (NM_016238) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC7 (NM_001137664) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC7 (NM_016238) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ANAPC7 (NM_016238) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ANAPC7 (NM_001137664) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ANAPC7 (NM_001137664) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack