Germany
Japan
United Kingdom
China
Anapc7 (Myc-DDK-tagged) - Mouse anaphase promoting complex subunit 7 (Anapc7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ANAPC7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN419871 is the updated version of KN219871.
Anapc7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501227 is the updated version of KN301227.
Anapc7 (GFP-tagged) - Mouse anaphase promoting complex subunit 7 (Anapc7), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Anapc7 (Myc-DDK-tagged) - Mouse anaphase promoting complex subunit 7 (Anapc7)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Anapc7 (Myc-DDK-tagged) - Mouse anaphase promoting complex subunit 7 (Anapc7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Anapc7 (mGFP-tagged) - Mouse anaphase promoting complex subunit 7 (Anapc7)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Anapc7 (GFP-tagged) - Mouse anaphase promoting complex subunit 7 (Anapc7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ANAPC7 (Myc-DDK tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ANAPC7 (mGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 900.00
6 Weeks
Lenti ORF particles, ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ANAPC7 (mGFP-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 900.00
6 Weeks
Lenti ORF particles, ANAPC7 (mGFP-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ANAPC7 (GFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ANAPC7 (GFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Anapc7 (Myc-DDK-tagged ORF) - Rat anaphase promoting complex subunit 7 (Anapc7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Anapc7 (Myc-DDK-tagged ORF) - Rat anaphase promoting complex subunit 7 (Anapc7), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Anapc7 (Myc-DDK-tagged ORF) - Rat anaphase promoting complex subunit 7 (Anapc7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Anapc7 (mGFP-tagged ORF) - Rat anaphase promoting complex subunit 7 (Anapc7), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Anapc7 (GFP-tagged ORF) - Rat anaphase promoting complex subunit 7 (Anapc7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
ANAPC7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ANAPC7 CRISPRa kit - CRISPR gene activation of human anaphase promoting complex subunit 7
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Anapc7 CRISPRa kit - CRISPR gene activation of mouse anaphase promoting complex subunit 7
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ANAPC7
Anapc7 (untagged) - Mouse anaphase promoting complex subunit 7 (Anapc7), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Anapc7
ANAPC7 MS Standard C13 and N15-labeled recombinant protein (NP_057322)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anapc7 (untagged ORF) - Rat anaphase promoting complex subunit 7 (Anapc7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of anaphase promoting complex subunit 7 (ANAPC7) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of anaphase promoting complex subunit 7 (ANAPC7) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7) transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anapc7 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anapc7 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anapc7 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Anapc7 |
ANAPC7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ANAPC7. |
Transient overexpression of ANAPC7 (NM_016238) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC7 (NM_001137664) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ANAPC7 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ANAPC7 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- ANAPC7