Germany
Japan
United Kingdom
China
DOCK2 (Myc-DDK-tagged)-Human dedicator of cytokinesis 2 (DOCK2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, DOCK2 (Myc-DDK tagged) - Human dedicator of cytokinesis 2 (DOCK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
DOCK2 (GFP-tagged) - Human dedicator of cytokinesis 2 (DOCK2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human dedicator of cytokinesis 2 (DOCK2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
DOCK2 (untagged)-Human dedicator of cytokinesis 2 (DOCK2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Purified recombinant protein of Human dedicator of cytokinesis 2 (DOCK2), Ala1544-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-DOCK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DOCK2 antibody: synthetic peptide directed towards the middle region of human DOCK2. Synthetic peptide located within the following region: ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA |
USD 420.00
4 Weeks
Transient overexpression of DOCK2 (NM_004946) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DOCK2 (NM_004946) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DOCK2 (NM_004946) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DOCK2
Families
- Druggable Genome