Germany
Japan
United Kingdom
China
DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Homo sapiens dipeptidyl-peptidase 6 (DPP6), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human dipeptidyl-peptidase 6 (DPP6), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DPP6 (mGFP-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, DPP6 (Myc-DDK tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DPP6 (mGFP-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DPP6 (myc-DDK-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DPP6 (GFP-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of DPP6 (mGFP-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DPP6 (mGFP-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dipeptidyl-peptidase 6 (DPP6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DPP6 (Myc-DDK tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dipeptidyl-peptidase 6 (DPP6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DPP6 (mGFP-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DPP6 (Myc-DDK tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DPP6 (mGFP-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DPP6 (myc-DDK-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DPP6 (GFP-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DPP6 (GFP-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of DPP6 (mGFP-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
DPP6 (untagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
DPP6 (untagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
DPP6 (untagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC310075 is the updated version of SC125379.
Lenti-ORF clone of DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DPP6 / Dipeptidylpeptidase 6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chimpanzee, Xenopus, Gorilla, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | DPP6 / Dipeptidylpeptidase 6 antibody was raised against synthetic 18 amino acid peptide from extracellular domain of human DPP6. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Horse, Rabbit, Xenopus (100%); Pig, Opossum, Platypus, Lizard (94%); Turkey, Chicken, Zebrafish (89%); Stickleback, Pufferfish (83%). |
Rabbit Polyclonal Anti-DPP6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ |
DPP6 / Dipeptidylpeptidase 6 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Immunogen | DPP6 / Dipeptidylpeptidase 6 antibody was raised against synthetic 18 amino acid peptide from near the center of human DPP6. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Gibbon, Monkey (94%); Horse (89%); Panda, Bovine (83%). |
Rabbit Polyclonal Anti-DPP6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT |
DPP6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DPP6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of dipeptidyl-peptidase 6 (DPP6), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of dipeptidyl-peptidase 6 (DPP6), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
DPP6 MS Standard C13 and N15-labeled recombinant protein (NP_570629)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
DPP6 MS Standard C13 and N15-labeled recombinant protein (NP_001927)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
DPP6 MS Standard C13 and N15-labeled recombinant protein (NP_001034439)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
DPP6 (GFP-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DPP6 (GFP-tagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DPP6 (untagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DPP6 (untagged) - Human dipeptidyl-peptidase 6 (DPP6), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of DPP6 (NM_130797) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DPP6 (NM_001936) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- DPP6
Families
- Druggable Genome