ERCC3 (Myc-DDK-tagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ERCC3 (Myc-DDK-tagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ERCC3 (Myc-DDK tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ERCC3 (mGFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ERCC3 (GFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ERCC3 (Myc-DDK tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ERCC3 (mGFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ERCC3 (myc-DDK-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ERCC3 (myc-DDK-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ERCC3 (untagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ERCC3 (untagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ERCC3 / XPB Mouse Monoclonal (aa242-261) (3G4) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
ERCC3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ERCC3 |
Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal antibody to XPB (excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing))
Applications | IF, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 521 and 742 of XPB (Uniprot ID#P19447) |
ERCC3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Anti-ERCC3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 270 amino acids of human excision repair cross-complementing rodent repair deficiency, complementation group 3 |
Rabbit Polyclonal Anti-ERCC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG |
Carrier-free (BSA/glycerol-free) ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERCC3 (GFP-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ERCC3 (GFP-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ERCC3 (untagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ERCC3 (untagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERCC3 mouse monoclonal antibody,clone OTI6H8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERCC3 mouse monoclonal antibody,clone OTI6H8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ERCC3 (NM_001303416) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ERCC3 (NM_001303418) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ERCC3 (NM_001303416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ERCC3 (NM_001303418) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack