Germany
Japan
United Kingdom
China
PROC (Myc-DDK-tagged)-Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, PROC (Myc-DDK tagged) - Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PROC (mGFP-tagged) - Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PROC (GFP-tagged) - Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PROC (Myc-DDK tagged) - Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PROC (mGFP-tagged) - Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PROC (untagged)-Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PROC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PROC antibody: synthetic peptide directed towards the middle region of human PROC. Synthetic peptide located within the following region: PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD |
Rabbit anti-PROC Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PROC |
PROC (untagged)-Human protein C (inactivator of coagulation factors Va and VIIIa) (cDNA clone MGC:34565 IMAGE:5188604), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PROC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PROC antibody: synthetic peptide directed towards the N terminal of human PROC. Synthetic peptide located within the following region: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL |
Lenti ORF clone of Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Protein C (PROC) mouse monoclonal antibody, clone CaC-11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
PROC HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Protein C (PROC) mouse monoclonal antibody, clone HLW-C, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal antibody to Protein C (protein C (inactivator of coagulation factors Va and VIIIa))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 145 and 461 of Protein C (Uniprot ID#P04070) |
Rabbit polyclonal PROC (light chain, Cleaved-Leu179) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PROC. |
Transient overexpression lysate of protein C (inactivator of coagulation factors Va and VIIIa) (PROC)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PROC MS Standard C13 and N15-labeled recombinant protein (NP_000303)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PROC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of PROC (NM_000312) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PROC (NM_000312) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PROC (NM_000312) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PROC
Families
- Druggable Genome